KEGG   Methanothermobacter thermautotrophicus: MTH1553Help
Entry
MTH1553           CDS       T00009                                 

Definition
tungsten formylmethanofuran dehydrogenase subunit H
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTH1553
  Energy metabolism
   00680 Methane metabolism
    MTH1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1420650..1421150
Genome map
AA seq 166 aa AA seqDB search
MINTHGDPMPKHIVSGLKYIAAVNLTKQGHSQREIAKALNMNRSTVSHYLNGRNLSWRSI
EVAKVITEMCPRDFLLLTHSLTQNTEMTRTIIRTCQKQKFQGKVRNSCIGCGLCVDTCLM
KAISLRDLKAHIESEWCCGCLICVDMCPTDSIEIKEVELDGNNRSN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgattaacacacatggtgaccctatgccgaaacatatagtttctggactcaaatacata
gcagctgtaaatctgacaaagcagggccattcacagagagagatagctaaggctctcaac
atgaacagatcaactgtttctcactacctcaacggcaggaacctctcctggaggtcaata
gaggttgcaaaggtaataacagagatgtgtccaagggacttccttcttctcacccactcc
cttacacagaacacagagatgacaaggaccatcataaggacatgccagaagcagaaattc
cagggaaaggtcaggaactcatgtattgggtgcgggctatgtgtggacacatgccttatg
aaggccataagtttaagagacctcaaggcacatatagaatccgaatggtgctgcgggtgt
ctcatctgtgttgatatgtgtccaactgattctatagaaataaaggaggtagaacttgat
ggaaacaaccgaagtaattga

DBGET integrated database retrieval system