KEGG   Methanothermobacter thermautotrophicus: MTH1584Help
Entry
MTH1584           CDS       T00009                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTH1584
   00030 Pentose phosphate pathway
    MTH1584
   00051 Fructose and mannose metabolism
    MTH1584
   00052 Galactose metabolism
    MTH1584
   00500 Starch and sucrose metabolism
    MTH1584
   00520 Amino sugar and nucleotide sugar metabolism
    MTH1584
  Nucleotide metabolism
   00230 Purine metabolism
    MTH1584
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MTH1584
Enzymes [BR:mth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MTH1584
    5.4.2.8  phosphomannomutase
     MTH1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450455..1451822
Genome map
AA seq 455 aa AA seqDB search
MKKLFGTFGVRRLANEVLTPEFASKLAAAYGSTVEGKIAVGGDTRTSTVMIKNAVISGLL
SSGCDVVDLGILPTPAVQYAVRKYYDGGVIVTASHNPPQYNGIKFVDSDGIGIPDDLEEE
IERIFFSEDFRRASWDKIGNLTSNPSIIREYQDGVIARVDAEAIRRRKFRVVVDCGCGAA
SYTMPYILRRLGCQVIALNSQPDGFFPGRDPEPVPENLSELMETVRSTGADLGIAHDGDA
DRTICIDERGEFVLGDKTFALVEKRMLQEKGGGIIVTTVATSSAIYDIASENNGEVITTA
VGDLLVARKLKETDGLFGGEENGGLIFPDFVYGRDAALTAATILEIMAHEDRPLSALVSE
LPAYYSSKRKIECPDEIKGDVMDLVSKMLADEEGVRDIDTTDGVKIFSEAGWVIIRPSGT
EPIFRCFAESETQEQADEMARWGISLVERAMEKLK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactatttggcacattcggagttagaagacttgcaaatgaggttttaacacct
gaattcgcatcaaagcttgcggcagcatacggttcaactgtagaagggaaaatagctgtt
ggaggagatacaaggacatccactgtaatgataaagaatgctgtcatatccggccttctt
tcaagcggatgtgatgttgttgacctgggaatactcccaacgccagccgttcagtatgca
gtcagaaaatattatgatggaggggttatcgtaacggcgtcccacaaccccccacagtac
aacggtataaaattcgttgactcagacggcataggcatccctgatgacctggaggaggaa
atagaaaggatattcttcagcgaagatttcaggagggcctcctgggataaaatcggaaac
ctcacatcaaacccctccataatcagggagtaccaggacggtgtcatagcgagggtcgat
gcagaggccatccgtagaaggaaattccgggtggtggtcgactgtggctgtggagcagcg
tcctacaccatgccctacatcctcaggaggctcggatgtcaggtgatagcacttaactct
cagcctgatggtttcttcccgggccgtgaccctgaacctgtccctgagaacctctcggag
ctgatggagactgtgaggtcaaccggggctgatctgggcatagcccacgacggtgacgca
gacaggacaatatgtatcgatgagaggggagaatttgtcctcggcgataagacattcgcc
cttgttgagaagaggatgctccaggaaaagggtggaggcataatagtcaccaccgtcgca
acatcctcagcaatatacgatatagcatcagagaacaacggagaggtaataacaacagct
gtaggggacctcctggtggcaagaaaacttaaagagacagacggactatttggaggcgag
gaaaacggtggattaatattccccgactttgtatacgggagggacgcagccctcacagcc
gccacgatactcgagataatggcccatgaggacaggccactatcagcgcttgtatcggaa
ctacccgcatattactccagtaagaggaaaatagaatgtcccgatgaaattaaaggggat
gtgatggacctggtaagtaagatgctggcagatgaggagggtgtaagggacatagatacc
acagacggtgttaaaatattcagtgaagccgggtgggtcataataaggccctcagggacc
gagccaatattcagatgcttcgcagagtcagagacacaggagcaggcagatgaaatggcc
cgctggggcatatccctggtcgagagggccatggaaaaactgaaatag

DBGET integrated database retrieval system