KEGG   Methanothermobacter thermautotrophicus: MTH1659Help
Entry
MTH1659           CDS       T00009                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTH1659
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTH1659
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTH1659
Enzymes [BR:mth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTH1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1522508..1523686
Genome map
AA seq 392 aa AA seqDB search
MIMDGKFGKYGGIFVPELLIPALEELERAFLHYRDDRKFMAELEYHLREYAGKPTGLYYA
RNLSEKLGCRVYLKREDMLHTGAHKINNTIGQALLARYMGKTRIIAETGAGQHGIATAAA
GALFGMDVDIYMGTEDVERQKLNVFRMEVSGAEVIPVDSGSRTLKDAINEAMRDWISNVD
DTHYLIGSTMGPHPYPTMVKHFQSVIGREAREQILEVEGELPDTVIACVGGGSNAIGIFS
AFMDDDVELIGAEGGGEGIESGNHGATLSAGSEGILHGSLSYVLQDGDGQISEAHSVSAG
LDYPGVGPEHAHLMDTGRARYEPVTDTEALRGFRLLSRYEGIMPALESAHAIACLERYAE
KPENRGKTVIVNLSGRGDKDMFMVAGLLGVGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgataatggatggaaaattcggtaaatatggaggcatattcgtgccggagcttcttata
ccggcacttgaggaacttgagagggccttcctccattacagggatgacaggaagttcatg
gctgaactcgagtaccatctccgggagtacgctggaaagcccacaggcctttactatgcc
aggaacctgtcagagaaactcggatgcagggtgtacctcaagagggaggacatgctgcac
acaggggcccacaagataaacaacaccataggccaggctctgctcgcaaggtacatgggc
aagaccaggatcatagccgagacaggggcagggcagcacgggatagccaccgccgctgcc
ggggccctctttggaatggacgttgatatctacatgggcacagaggatgttgagaggcag
aagctcaatgtattcagaatggaggtatcaggtgcggaggtcataccggtcgactcaggt
tcaaggacccttaaggacgccataaacgaggccatgagggactggattagcaacgtggat
gacacccactacctcataggttccaccatgggcccccacccctacccgaccatggtgaag
cacttccagagcgtcatagggagggaggccagggaacagatactcgaagtcgagggagaa
cttccagacacggttatagcgtgtgttgggggcggaagcaatgccataggcatattctct
gccttcatggatgatgatgttgaactcataggtgcagaggggggtggagaaggtatagag
tcaggaaaccatggagccacactctctgcgggctcagagggaatccttcatggttcatta
tcatacgtccttcaggatggggatggtcagataagtgaggcacattctgtctcagctggt
ctggattatccgggtgttggaccagaacacgcccatctcatggatacaggcagggcaagg
tatgagccggtaacagacaccgaggcactcaggggcttcaggctcctctcaagatatgag
ggtataatgccagcccttgagagtgcccatgcaatagcctgccttgaaaggtacgctgag
aaacctgagaaccggggaaaaacggttatcgtcaatctctcaggaaggggagataaggac
atgttcatggttgctggtttgctgggggtgggtgtgtga

DBGET integrated database retrieval system