KEGG   Methanothermobacter thermautotrophicus: MTH1659Help
Entry
MTH1659           CDS       T00009                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTH1659
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTH1659
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTH1659
Enzymes [BR:mth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTH1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1522508..1523686
Genome map
AA seq 392 aa AA seqDB search
MIMDGKFGKYGGIFVPELLIPALEELERAFLHYRDDRKFMAELEYHLREYAGKPTGLYYA
RNLSEKLGCRVYLKREDMLHTGAHKINNTIGQALLARYMGKTRIIAETGAGQHGIATAAA
GALFGMDVDIYMGTEDVERQKLNVFRMEVSGAEVIPVDSGSRTLKDAINEAMRDWISNVD
DTHYLIGSTMGPHPYPTMVKHFQSVIGREAREQILEVEGELPDTVIACVGGGSNAIGIFS
AFMDDDVELIGAEGGGEGIESGNHGATLSAGSEGILHGSLSYVLQDGDGQISEAHSVSAG
LDYPGVGPEHAHLMDTGRARYEPVTDTEALRGFRLLSRYEGIMPALESAHAIACLERYAE
KPENRGKTVIVNLSGRGDKDMFMVAGLLGVGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgataatggatggaaaattcggtaaatatggaggcatattcgtgccggagcttcttata
ccggcacttgaggaacttgagagggccttcctccattacagggatgacaggaagttcatg
gctgaactcgagtaccatctccgggagtacgctggaaagcccacaggcctttactatgcc
aggaacctgtcagagaaactcggatgcagggtgtacctcaagagggaggacatgctgcac
acaggggcccacaagataaacaacaccataggccaggctctgctcgcaaggtacatgggc
aagaccaggatcatagccgagacaggggcagggcagcacgggatagccaccgccgctgcc
ggggccctctttggaatggacgttgatatctacatgggcacagaggatgttgagaggcag
aagctcaatgtattcagaatggaggtatcaggtgcggaggtcataccggtcgactcaggt
tcaaggacccttaaggacgccataaacgaggccatgagggactggattagcaacgtggat
gacacccactacctcataggttccaccatgggcccccacccctacccgaccatggtgaag
cacttccagagcgtcatagggagggaggccagggaacagatactcgaagtcgagggagaa
cttccagacacggttatagcgtgtgttgggggcggaagcaatgccataggcatattctct
gccttcatggatgatgatgttgaactcataggtgcagaggggggtggagaaggtatagag
tcaggaaaccatggagccacactctctgcgggctcagagggaatccttcatggttcatta
tcatacgtccttcaggatggggatggtcagataagtgaggcacattctgtctcagctggt
ctggattatccgggtgttggaccagaacacgcccatctcatggatacaggcagggcaagg
tatgagccggtaacagacaccgaggcactcaggggcttcaggctcctctcaagatatgag
ggtataatgccagcccttgagagtgcccatgcaatagcctgccttgaaaggtacgctgag
aaacctgagaaccggggaaaaacggttatcgtcaatctctcaggaaggggagataaggac
atgttcatggttgctggtttgctgggggtgggtgtgtga

DBGET integrated database retrieval system