KEGG   Methanothermobacter thermautotrophicus: MTH166Help
Entry
MTH166            CDS       T00009                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTH166
Enzymes [BR:mth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MTH166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(111171..111932)
Genome map
AA seq 253 aa AA seqDB search
MAVTRPPERSAEAVELIEGAGGRALVAPTLELKEAHTESLREVCRRADEWDLVIFTSQAA
VESLFQLCREFAGKIRKDCLVAVIGPRTARVAGEHGLRVDIVPEDYTAEGLLDALTGLNI
EGWKVALPRTLSARKVLPRGLEMMGAEVLVAEAYRSGLPEDTGPAEELIDGLLDGKVDAV
TFTSPLTVENLFKIAGNRRKELIEVLKRVKVAAIGPITLRKLEEHGITAVTPERYTVKDM
IAALAVSMGEDVD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtgacacggccccctgaaagatctgcagaggctgttgaactgatagagggggca
ggtggaagggccctcgtggccccgacccttgaattaaaggaggcgcacacagaatccctc
agggaagtctgccggagggctgatgaatgggatcttgtaatattcacgtcacaggccgcc
gttgaatccctcttccagctctgcagagaatttgcagggaaaatcaggaaggactgcctg
gtggcagttataggtcccaggaccgccagagtggccggtgagcatggactccgggtcgat
atcgtcccggaggattatactgccgagggcctcctggatgccctcaccggtctcaacatt
gagggctggaaggtggctctcccaaggacactctctgcaaggaaggtccttccccgagga
cttgagatgatgggtgcagaggtcctcgtggccgaggcctacagatccggtttacctgaa
gacaccggccccgcagaggagcttatagatggtctcctggatggaaaggtggatgcagtc
accttcacaagccccctcactgttgagaacctcttcaaaatcgccggtaaccggcgtaaa
gagctcatagaggttctgaagagggttaaggtggctgcaataggccccataaccctcagg
aagctggaggagcatggaatcaccgccgtgacacccgaaaggtacaccgtgaaggatatg
atagctgcgctcgcagttagcatgggtgaagatgtggactga

DBGET integrated database retrieval system