KEGG   Methanothermobacter thermautotrophicus: MTH1660Help
Entry
MTH1660           CDS       T00009                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mth01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mth00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mth00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1523724..1524545
Genome map
AA seq 273 aa AA seqDB search
MIVMSGAKSMSYAEMFRRADGCAFVPFVVAGDPDMETSLEIIRTLVDAGADALEVGFPFS
DPIADGTSVQGADLRALRAGMTTEKCFQLIERVREFTSIPIGLLVYYNLIYRMGVDEFYR
RAAEAGVTGILAADLPPEEASDALRAAEKYDIDQIFIVAPTTGSERLKRISEVSSGFHYL
VSVMGVTGARSRVEDATIELIKRVKAEGSLPVMVGFGVSRPEHVRMLRDAGADGVIVGSA
IIDVISGNLGDRELMLQRIHEMAGTLKAAGGSG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtaatgtcaggagctaaatcaatgagttatgctgagatgttcagacgggcggat
ggctgtgccttcgtccccttcgtggttgcaggggaccctgatatggagacatcccttgag
atcataaggacccttgtggatgcaggggccgatgcccttgaggtaggcttcccattctct
gacccaatagcagatggtacaagcgttcagggcgctgatctgcgggccctcagggcaggc
atgacaaccgagaagtgcttccagcttatagagagggtccgggaattcacttccataccc
ataggcctgctggtatactacaacctgatctacaggatgggtgttgatgagttctaccgg
agggctgcagaagcaggggtcacagggatacttgcagcggatctcccccctgaagaggcc
tcagatgcactcagggccgctgaaaaatatgatatagatcagatattcatagttgcacca
acaaccggtagtgaacgcctcaaaaggatctctgaggtctcatcaggatttcactacctc
gtctcggtgatgggggtcaccggcgcaagatcaagggttgaggatgcaaccatcgaactc
ataaaaagggtgaaggctgagggaagtctgccggtaatggttggattcggtgtatcaaga
cccgaacatgtgaggatgctgagggatgcaggagccgatggagttatcgtcggaagcgcc
atcatagacgtgatatccgggaacctcggcgacagggagcttatgctccagaggatccat
gaaatggcaggcactctgaaagccgcaggaggatcaggatga

DBGET integrated database retrieval system