KEGG   Methanothermobacter thermautotrophicus: MTH1686Help
Entry
MTH1686           CDS       T00009                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTH1686
   01230 Biosynthesis of amino acids
    MTH1686
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTH1686
   00030 Pentose phosphate pathway
    MTH1686
   00051 Fructose and mannose metabolism
    MTH1686
  Energy metabolism
   00680 Methane metabolism
    MTH1686
Enzymes [BR:mth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MTH1686
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MTH1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545418..1546515
Genome map
AA seq 365 aa AA seqDB search
MKTTISVIKADVGSVAGHAVAHEALKKKCDEILAGAKETGILEDYYITNCGDDIDLIMTH
RNGEENEEVHQTAWNAFREATDVARGLKLYGAGQDLLSDTFSGNIKGMGPGCAEMEFKER
PSDPVIIFCCDKTEPGAFNLPLFRMFADPFNTAGLVIDPSLHNGYEFEVFDVVEHKKVTM
ACPDEMYDLLALLGSISRYVIKRIHRRDDGEIAASVSTERLNLMAGKYIGKDDPVAIVRA
QSGFPAAGEVVEPFAFPHLVGGWMRGSHNGPLMPVAQRDATPVRFDGPPRVIALGFQVAD
CKLVGPVDMFDDPSFDRSRQLASEVAEYMRRHGPFEPHRLPSDEMEYTSLPGVLEKLGDR
FEDME
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccattagtgtaattaaagcagacgttggaagtgtagccggtcatgcagtt
gcccatgaagctttaaagaagaaatgcgacgagatactggccggcgcaaaggagaccgga
atccttgaggattactatataaccaactgtggggacgacatagacctcatcatgacccac
agaaacggtgaagaaaacgaggaggtccaccagacagcgtggaatgctttcagggaagcg
acagatgttgcaagaggtttaaaattgtatggggctggacaggatctcctttcagatacc
ttctcaggtaacataaagggtatgggtcccggctgtgccgagatggagttcaaggagagg
ccaagcgaccctgttataatcttctgctgcgacaaaacagaaccgggtgcctttaacctc
ccactgttcagaatgttcgctgatccattcaacacagcgggtcttgtgatcgacccctca
ctccacaatggatacgaatttgaggtctttgacgtcgtcgaacacaaaaaggttacaatg
gcatgtcctgatgagatgtacgacctcctggcgcttctcggttcaatcagccgctatgtc
atcaagaggatacacagaagggacgatggtgaaattgcagcctcagtgagtacagagagg
ctgaacctcatggcaggtaaatacataggtaaggacgacccggtcgcaatagtcagggca
cagtccggattccctgcagcaggtgaggtcgttgagcccttcgcattcccccacctcgtc
ggcggatggatgaggggatcccacaacggaccactgatgcctgtggcccagagggatgca
acacccgtgagattcgatggaccaccaagggtcatagccctgggattccaggtagctgat
tgcaagcttgtcggacccgttgacatgtttgatgatccatcctttgaccgctcaaggcag
ctcgcctctgaggttgcagagtatatgaggaggcacggtccatttgagccacacaggctc
ccatcagatgagatggaatacacctcactacccggtgtgcttgaaaaactcggcgacagg
tttgaggatatggaatga

DBGET integrated database retrieval system