KEGG   Methanothermobacter thermautotrophicus: MTH1738Help
Entry
MTH1738           CDS       T00009                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTH1738
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTH1738
   00020 Citrate cycle (TCA cycle)
    MTH1738
   00620 Pyruvate metabolism
    MTH1738
   00640 Propanoate metabolism
    MTH1738
   00650 Butanoate metabolism
    MTH1738
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTH1738
   00680 Methane metabolism
    MTH1738
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MTH1738
Enzymes [BR:mth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MTH1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1589189..1590055)
Genome map
AA seq 288 aa AA seqDB search
MKIPEEEFLAPGHRGCAGCGATVGVRLALKVLGKNTVAVSSTGCLEVITTPYPETAWRIP
WIHVAFENAAAVASGVERALKAKGRDDVNVVAFAGDGGTADIGLQALSGAMERGHNIIYI
CYDNEAYMNTGIQRSASTPYGASTTTSPHGKESFGEDRPKKNMPLIMAAHGVPYVATASI
SYPEDFMEKVRKAKETDGPAYIHLHQPCTTGWGFDPAKTVELGRLAVETGSWILYEIEDG
DFRVTYRPVQRKPVEEYLNAQKRFRHLTEEQKARIQEYVDSVCQELRI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacctgaagaagaatttctggccccagggcaccgtggatgcgcaggatgcggt
gctacagttggagtcaggctggccctgaaggttcttggaaagaacaccgtagcagtatca
tcaacaggttgccttgaagttatcaccacaccctaccctgaaaccgcatggaggataccc
tggatacatgttgcatttgaaaacgccgctgcagttgcatcaggcgttgaaagggctctg
aaggcaaagggaagggatgacgttaacgtagtggcctttgcaggtgatggtggaacagca
gacatcggactacaggcactatccggtgcaatggagaggggccacaacatcatatacatc
tgctacgataacgaggcctacatgaacaccggtatacagaggagtgcctcaacaccctac
ggtgcctcaacaaccacatcaccccatgggaaggagagcttcggtgaggacagacccaag
aagaacatgccactcataatggcagcccatggagtgccctacgttgccaccgcatcaata
tcatatcctgaggacttcatggagaaggtcagaaaggccaaggaaaccgatggtcctgcc
tatatacaccttcaccagccatgcacaaccggatggggttttgatcctgcgaagacagtg
gaactcggaaggctggcagttgaaaccgggtcctggatactctatgagatagaggatggt
gatttcagggtcacctacagaccagtgcagaggaaacccgttgaggagtacctcaacgca
cagaaaaggttcagacacctcacagaggaacagaaggccagaatccaggaatacgttgac
agtgtatgccaggaactcaggatatag

DBGET integrated database retrieval system