KEGG   Methanothermobacter thermautotrophicus: MTH1739Help
Entry
MTH1739           CDS       T00009                                 

Definition
pyruvate oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTH1739
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTH1739
   00020 Citrate cycle (TCA cycle)
    MTH1739
   00620 Pyruvate metabolism
    MTH1739
   00640 Propanoate metabolism
    MTH1739
   00650 Butanoate metabolism
    MTH1739
  Energy metabolism
   00680 Methane metabolism
    MTH1739
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MTH1739
Enzymes [BR:mth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MTH1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1590052..1591203)
Genome map
AA seq 383 aa AA seqDB search
MVLKVISANQAVAEAAKLAKPKVIPVYPITPQTSISEYLAKFVADGELKAEYIRVESEHS
AMSACVGASGAGVRVFTATSSQGLALMHEIVYAAAGLRNPIVMANANRALSAPLSIWNDQ
QDSIAERDSGWMQIYVESGQEALDSVLLSYRVSEDRDVLLPSMVCLDGFILTHTVEPVDI
PSQEDVDSFLPEFQPQVMLDPDEPMSLGTFTDPDYYMEARYEVEKAMERSRKIIERACRE
FSEMFGREYGLVEEYRCEDAEIILVAMGSVCSTLREVIDELRDKGKAVGLLKVRVHRPFP
AEEIKSAVRNASKVAVLDKNITFSVGGALYTEISALLRDREVYGFIVGLGGRDITPAHIE
EIVRRTENPERSVTWIGLKEESE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggttcttaaggttatatcagcaaatcaggccgttgcagaagcagcaaagcttgcaaaa
ccaaaggtcattcctgtttaccccataacaccccagacctcaatttcagagtaccttgca
aaattcgtggctgatggcgaactcaaagcagaatacataagggttgaatcagagcacagt
gcaatgagcgcatgcgtgggcgcctcaggagctggagttcgggttttcaccgcaacctcc
tcccagggactggcgcttatgcatgagatagtctatgctgcagcagggctcaggaatccc
atcgtaatggcaaatgcaaaccgcgccctctccgcacccctcagcatatggaatgaccag
caggattcaatagcagagcgggactcagggtggatgcagatatacgttgaaagtggacag
gaagccctcgattctgtccttctatcctacagggtatcagaggacagggatgttctgctg
cccagtatggtgtgcctcgatgggttcatcctgacccacacagttgaacccgtggacatc
ccctcacaggaggatgttgacagcttcctccctgaattccagccccaggtaatgcttgac
cctgatgagcccatgtcactgggtaccttcacagaccctgactattacatggaggcccgc
tatgaggtcgagaaggccatggagcgttcaaggaagatcattgaaagggcatgcagggaa
ttcagcgaaatgttcggccgggagtacggccttgttgaggaatatcgctgtgaagatgca
gaaataatcctggtggccatgggttcagtctgcagcaccctcagggaggtcatcgatgaa
ctccgggataagggaaaggccgttggactacttaaggtcagggtgcacagacccttcccg
gctgaggagattaaaagtgctgttaggaatgccagtaaagtagcggtcctcgataagaac
ataacattcagtgtcggcggagccctttacacagagataagtgccctgctccgtgacagg
gaagtttatggattcattgtgggccttggtggaagggacataacacccgcacacatcgag
gaaatagttagaaggacggaaaaccctgaaaggagcgtcacctggatcggtctcaaggag
gaatcagaatga

DBGET integrated database retrieval system