KEGG   Methanothermobacter thermautotrophicus: MTH1768Help
Entry
MTH1768           CDS       T00009                                 

Definition
hypothetical protein
Orthology
K07562  
nonsense-mediated mRNA decay protein 3
Organism
mth  Methanothermobacter thermautotrophicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621379..1622437)
Genome map
AA seq 352 aa AA seqDB search
MFCVRCGSSDSELYEGLCRDCFLEDYSILRIPDRIEVRVCSHCRAKFISGQWLDEGLPDE
EIVYRALEDSISWDEPVENPEIELEIMQERGTIYRCLVEVDAEVLGKRLSQEYEVEVRIT
NTVCPTCSKQSSGYYEAVIQLRADGRELAETEIETADRVVQRTLLKLSRRDKLAYLPQRV
EVKEGVDYYIGSHKSARKVVDAIREKLGGITMESPRLMGQDKSTGKGLYRTWISLRLANF
RVGDFLSHHNRILAVIDLRKKGVSVRDLETREVKNILWGEYEDMDVVGRADDVKTTTVTS
RSPGMIQILHPETFEPVDLEADSYTSTLDIGEQVPVIEIDKRLYIIEDEAEE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtgtcagatgcggtagttctgattctgaattatatgaaggcctctgcagggac
tgtttccttgaggactacagtatcctcaggatacctgacagaatagaggtcagggtatgc
agccactgccgtgcaaagtttataagtggtcagtggctggatgaaggactcccagacgag
gaaatcgtgtacagggcccttgaggacagtataagctgggatgaacccgttgagaaccct
gaaatcgaactcgaaataatgcaggagaggggcaccatctacaggtgccttgtggaggtt
gatgcagaggtcctcgggaagcggctcagccaggaatacgaggtggaggtccgcatcacc
aacacagtatgccccacctgcagtaaacagagctccggctactatgaggcggttatacag
ctgagggccgatggaagggaacttgcagaaaccgaaatagaaacagctgacagggttgtc
cagaggacactcctgaaactttccaggcgggacaaactggcctacctcccccagagggtt
gaggtgaaggagggtgttgactactacataggatcccacaaatccgcccggaaggttgtg
gacgccatccgggagaaactcggggggataacaatggagtcccccagactcatgggtcag
gacaaatcgacgggcaagggcctctacaggacgtggatatccctcaggcttgcgaatttc
agggttggagactttctatcccaccataacagaattctggcagtcattgacctccgaaag
aagggcgtgagtgtgagggaccttgagacccgtgaggtaaagaacatactctggggggaa
tatgaggatatggatgttgtgggccgtgcagatgatgtgaagaccaccactgtaacctca
agatcccctggaatgatccagatactccacccggaaacctttgaacccgtggaccttgag
gcggacagctacacatcaacactggatataggggaacaggtccctgtcatagaaatcgat
aaaagactctacatcatcgaggatgaggcggaggaatga

DBGET integrated database retrieval system