KEGG   Methanothermobacter thermautotrophicus: MTH217Help
Entry
MTH217            CDS       T00009                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTH217
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTH217
   00620 Pyruvate metabolism
    MTH217
   00640 Propanoate metabolism
    MTH217
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTH217
   00680 Methane metabolism
    MTH217
Enzymes [BR:mth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MTH217
Lipid biosynthesis proteins [BR:mth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MTH217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(158105..159781)
Genome map
AA seq 558 aa AA seqDB search
MSKDTSVLLEEKRVFKPHYTVVEEAHIKNWEAELEKGKDHENYWAEKAERFEWFRKWDRV
LDESNRPFYRWFVNGKINMTYNAVDRWLDTDKRNQVAILYVNERGDERKLTYYELYREVN
RTANALKSLGIKKGDAVALYLPMCPELVISMLACAKIGAVHSVIYSGLSVGALVERLNDA
RAKIIITADGTYRRGGVIKLKPIVDEAILQCPTIETTVVVKHTDIDIEMSDISGREMLFD
KLIEGEGDRCDAEEMDAEDPLFILYTSGSTGKPKGVLHTTGGYMVGVASTLEMTFDIHNG
DLWWCTADIGWITGHSYVVYGPLLLGTTTLLYEGAPDYPDPGVWWSIVEKYGVTKFYTAP
TAIRHLMRFGDKHPKRYNLESLKILGTVGEPINPEAWMWYYRNIGREKCPIIDTWWQTET
GMHLIAPLPVTPLKPGSVTKPLPGIEADVVDENGDPVPLGKGGFLVIRKPWPAMFRTLFN
DEQRYIDVYWKQIPGGVYTAGDMARKDEDGYFWIQGRSDDVLNIAGHRIGTAEVESVFVA
HPAVAEAAVIGKAYPIKG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaggatacctcagttctcctggaagagaaaagggtcttcaaaccccactacacc
gttgtggaggaggcccacataaaaaactgggaggccgagctcgaaaagggaaaggaccat
gagaactactgggccgaaaaggctgaaagattcgaatggttcagaaaatgggacagggtc
cttgatgagagcaacagaccattctacaggtggttcgtcaacggtaagatcaacatgacc
tacaacgccgttgacaggtggcttgacacagacaagagaaaccaggtcgccattctatac
gtgaacgagaggggggatgaaaggaagttaacctactatgaactgtaccgtgaggttaac
aggaccgctaatgccctcaaaagtcttggaatcaaaaagggcgatgcagttgccctctac
cttccaatgtgccccgaacttgtaatctcaatgcttgcctgtgcaaagataggtgctgtc
cacagtgtcatatactccggtctcagtgtgggggccctggtggaacgcctgaacgatgca
agggcaaagatcataataacagccgacggtacctacagaaggggcggggttataaagctc
aaacccatagtggacgaggccatactccagtgccccaccatagaaaccacagtggttgta
aagcacacagacatcgacattgagatgtcggatataagtggacgtgaaatgctcttcgat
aagctcatagagggtgaaggggaccggtgcgatgcagaggagatggatgcagaggacccc
ctcttcatactctacacttcggggagcaccggaaaaccaaagggtgttctacacacaaca
ggaggatacatggtgggggttgcatcaaccctcgagatgacctttgacatccacaacgga
gacctctggtggtgcacagcagacatcgggtggataacaggtcacagctatgttgtctat
ggcccgctgctacttggaaccacaacactcctctatgagggggcacctgattaccctgac
cccggtgtgtggtggagtatcgttgagaaatacggtgtcaccaagttctacacggcacca
accgcaataaggcacctcatgaggttcggtgacaagcacccaaaacgctacaaccttgaa
tccctcaagatacttggtacggtcggtgaacccataaaccctgaggcatggatgtggtac
tacaggaacattggaagggagaagtgcccgataattgacacctggtggcagaccgagaca
gggatgcacctcatagcacccctacctgtgacaccccttaaaccgggttcagtgacaaag
cccctcccgggcatagaggccgacgtggttgacgagaatggcgaccccgtgcccctgggt
aagggtggttttcttgtgatcagaaagccatggccagccatgttcaggaccctcttcaac
gacgagcagaggtacatcgatgtttactggaagcagatccccggcggagtgtacaccgca
ggtgacatggccaggaaggacgaggacggatacttctggatccagggaagatccgatgac
gtcctgaacatagcagggcacaggataggtactgcagaggttgaatcagtctttgtcgca
caccctgcagttgcagaagccgcggttataggcaaggcctaccccatcaaggggtag

DBGET integrated database retrieval system