KEGG   Methanothermobacter thermautotrophicus: MTH253Help
Entry
MTH253            CDS       T00009                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTH253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTH253
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MTH253
Enzymes [BR:mth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MTH253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196257..197477
Genome map
AA seq 406 aa AA seqDB search
MDGESVIRCISCGREYDLEEIIYTCRECGSVLEVECDVEVSRDVFRGRRQNMWRYREFMP
VDPSRIVSLDEGGTPFVRCDTIGSELGIELYVKVEGSNPTGSFKDRGMSVGITKALELGV
DTVGCASTGNTSASLAAYAARAGLGCVVLLPSGKVALGKLAQAMFHGARVLSVRGNFDEA
LEAVTELALMGELYLLNSVNPFRLEGQKSIGFEIVDDLGWESPDRIILPVGNAGNISAIW
KGISEFYRAGFIDERPMMTGIQAEGASPVVEAFRKGRTEIEPVRDPETVATAIRIGAPVS
YLKALRAIYESDGYAESVTDEEILSAQKLLARREGIGVEPASAASIAGLIKLVDEGVVDR
GERVVCVVTGHVLKDPDTAIKASTEPVEVEPDINQLRSIIRGTGSS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgaatctgtgataaggtgcatatcatgtggtcgagagtatgacctggaggag
atcatatacacctgcagggagtgcgggtcggtacttgaagttgaatgtgacgtggaggtc
tcaagggacgtcttcaggggcagaaggcagaacatgtggaggtacagggagttcatgcct
gttgacccctcaaggatagtcagcctcgatgaggggggaacaccctttgtcaggtgtgac
accataggatctgaacttggtattgagctctatgtgaaggtggagggctccaaccccaca
gggagcttcaaggacagggggatgagcgtggggatcacaaaggcccttgaacttggcgtt
gatactgtggggtgcgcctcaaccggtaacacctcagcctcccttgcagcctacgcagcc
agggctgggctgggctgcgtcgttctactcccatcaggtaaggtcgccctcggtaaactt
gcccaggctatgttccatggcgccagggtcctctcggtgaggggaaactttgacgaggcc
cttgaggctgtcacggaacttgcactgatgggtgaactctacctcctcaactccgtgaac
cccttcaggcttgagggtcagaagtcaataggctttgagatagtggatgacctcggctgg
gagtcccctgaccgcatcatactgcctgtggggaatgcaggtaatatctcagccatctgg
aagggtatatcagagttttacagggctggattcatagatgagaggccgatgatgaccggt
atacaggccgagggcgcttcaccggtggtagaagccttcaggaagggcagaaccgagatt
gaaccggtcagggatcctgaaacggttgcaacggccataaggataggggcccctgttagc
tatctcaaggccctccgggccatatatgagtcagatggttatgctgaatccgtgaccgat
gaggagatactctctgcccagaaactccttgcaaggagggagggtataggtgttgagccc
gcatcagcggcgtccatagcgggtctcatcaaactcgttgatgagggtgttgttgacagg
ggtgaacgtgtggtctgtgttgtcactggtcatgtactcaaggaccctgacaccgccata
aaggcatcaacggaaccagttgaggtagaacctgatataaaccagttaagatccattata
aggggtacggggtcctcctag

DBGET integrated database retrieval system