KEGG   Methanothermobacter thermautotrophicus: MTH404Help
Entry
MTH404            CDS       T00009                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MTH404
Enzymes [BR:mth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MTH404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341953..342849
Genome map
AA seq 298 aa AA seqDB search
MRFDAVGLGALNMDQLHMVERIAGPDEETFVRGLVESCGGSAANTMIGLSRLGLRTAHIG
KVADDREGGLLRSNLSSEGVTDFTVVADTGRSGRVMGFVDPDGNRALYVDPGVNDTLRVD
EVADEALNTELLHLTSFAGDGINVQVEVIEALDESVTVSLDPGHIYASRGVSELSDILER
TDILLTNQRELELMTGSADPEEAASLLGIGVVVVKMGARGVRAWDGESVMVDALSTECVD
TTGAGDAFNAGFIYAWLEGFGLEVSCRFGNYIASRCIGGYGATESLPGTGPGCPQEVR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcgatgcggtgggccttggagccctcaacatggaccagctccacatggttgag
aggatagcaggcccggatgaggagaccttcgtgagggggctcgtggaatcctgtgggggc
tcagcagccaacaccatgataggcctctcaaggctcggtctcaggacagcccacataggt
aaggtcgccgatgacagggaggggggactcctcaggagtaacctctcatctgagggggtc
acggatttcaccgtcgtagcggatacaggtagaagcggccgtgtgatgggcttcgttgac
cctgacggtaacagggccctctacgttgaccctggagtcaacgacacactcagggtggat
gaggtggctgatgaggcccttaacacagaactgctgcacctcacatccttcgcaggtgat
ggcataaatgtccaggtggaagtcattgaggcactggatgaatccgtgaccgtcagcctg
gatccaggacacatctacgcctcaaggggagtatctgagctgtcagatatcctcgagcgc
accgacatcctcctcacaaaccagagggaacttgagctgatgacagggtccgctgaccct
gaggaggcagcatcactcctgggaatcggggtggttgtggttaagatgggcgcccgaggc
gtcagggcatgggacggtgagtctgtgatggtggatgcactgagcaccgaatgtgttgat
acgacgggggccggtgacgccttcaatgctggcttcatatatgcctggctcgagggcttt
ggccttgaggtttcatgccgttttggaaactacatagcatcacggtgtatcggaggatac
ggtgccacagaatccctccccgggaccggccctggatgtcctcaggaggtacgctga

DBGET integrated database retrieval system