KEGG   Methanothermobacter thermautotrophicus: MTH414Help
Entry
MTH414            CDS       T00009                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MTH414
Enzymes [BR:mth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MTH414
Peptidases [BR:mth01002]
 Cysteine Peptidases
  Family C44
   MTH414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350625..352034
Genome map
AA seq 469 aa AA seqDB search
MTAMCAIAGFRGDDAPVKVQEMLDVLRHRGPDATGIYHDSRIVIRTATGEDVKEAPQSAE
IAVGHNLLSIVGGPQPVSGDGVLVFNGEIYNQEELNWTGSDSELILDLIEGHGGDLEDAL
RFTVNKIDGDYAFAYTDGENLASRQDPVGVKPLYHSGEAFASEKKALWRIGLRNVETLPP
GHAMINGVKVKLRGLPRAEPSDAEPEELRENLKSALRESVERRVRGLDEAALVFSGGVDS
TLLAVLLDEHIDVRLYTVGLPGSSDPQFASRAAADLGMELEVLEVTEDTIREALPHVLGA
IEEYNLMKIGVAMPLYLASEAASADGYRVMFSGQGADELFAGYHRYRRLLAEGRLEDALR
HDLENIHHVNLERDDAVTMANSVELRVPFLDLQLIGVALTIPADLKIRGPEDELRKRILR
EAALEMGVPEYIAMRPKKAAQYGSGIDKVLRRKVLPGFDHETFLRRLMF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgatgtgcgccattgcagggttcaggggtgatgacgccccggtaaaggtacag
gagatgttagatgtcctcagacaccggggccctgatgccacagggatctaccatgacagc
aggatagtgataaggacagcgacgggggaggatgtaaaggaggccccgcaatcagctgag
attgcagtgggccataacctcctctcaatcgtgggaggtcctcagccagtatcaggggac
ggcgtactggtatttaacggcgagatatacaatcaggaggaacttaactggaccggcagc
gactctgaactcatcctggacctcatagagggccacggcggggacctggaggatgcgctg
cgtttcacggttaacaagatagacggtgactacgccttcgcctacacagacggcgagaac
cttgcaagtcgtcaggaccctgttggtgtcaaacccctctaccattcaggggaggccttc
gcatccgaaaagaaggccctctggaggataggtctgaggaatgtggagaccctgccacct
ggccatgccatgataaacggtgtgaaggtgaagctgaggggactccccagggcggaaccc
tcagatgcagaaccagaagagctgagggagaatctcaaatcagctctgagggaatcggtg
gagaggagagttagaggtttggatgaggctgccctggtattctcgggcggcgttgacagc
acactgctggcggtcctccttgatgaacacatcgatgtgaggctctacaccgtggggctc
cctggttccagcgaccctcagttcgcatccagggctgcggcagaccttggaatggaactt
gaggtcctggaggttacagaggataccatcagggaggcccttccccatgtcctgggggcg
atagaggagtacaatctcatgaagatcggcgttgcaatgcccctctacctggcatctgag
gctgcctctgcagacggatacagggtcatgttctctggtcagggtgcagacgaacttttc
gcaggataccacaggtacaggcgcctcctggctgagggaagactcgaggacgccctccgg
catgaccttgaaaacatccaccatgttaaccttgaaagggatgacgcggttacaatggca
aactcggtggagctgagggtccccttcctggaccttcaactgataggggtggccctgacc
ataccagcagacctcaagatacggggcccggaggatgagctgaggaaacgcatactcagg
gaggcggcccttgagatgggggtccccgagtacattgcgatgaggcccaagaaggcggcg
cagtacggttcagggatagataaggtcctgcggaggaaggttctccctgggtttgaccat
gagaccttcctgaggaggctgatgttttaa

DBGET integrated database retrieval system