KEGG   Methanothermobacter thermautotrophicus: MTH437Help
Entry
MTH437            CDS       T00009                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371221..372252
Genome map
AA seq 343 aa AA seqDB search
MVIMKELMKRLSVASGISGFEGEVRDIIRSELEGHVDEIEEDSLGNIIAVKRGSGPSIML
AAHMDEIGLMVRHIDKKGFIRFSKIGGISDQMILNQAVWIHGENGPVMGVIGSKPPHRMK
ASERKKVTTHDNMFIDIGASSREDAEELVAVGDPITFHAPYSELANSRFTGKALDNRIGC
LVMVEVLKRVETGATVYGVGTVQEEVGLKGAKTSAFRLNPDMTLALDVTIAGDHPGMKEE
EAPAKLEGGPAIILTDASGRGIITHPRVKDWLLETAREEDIPVQIEVSEGGTTDATAIHL
TREGIPAGVVSVPTRYIHTTVSMASMKDIEMTVDLLVKAIERL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtggtaatcatgaaggaactcatgaagcgtctttcagttgcaagtggaatctctggattt
gaaggtgaggtaagggatatcataagatctgaactcgagggacatgtcgatgagattgag
gaggacagcctcggtaacatcatcgccgtgaagagggggtccggtccctcaatcatgctg
gcagcccacatggatgagataggcctcatggtgaggcacatcgataagaagggattcata
aggttttcaaagataggcggaatcagtgaccagatgatactcaaccaggcggtctggatc
catggggaaaacggacccgtgatgggtgtcatcggctcaaagccaccccacaggatgaag
gcctctgagaggaagaaggtcacaacccatgataacatgttcatagacataggcgcctct
tcaagggaggatgcagaggaactggtggctgtgggggaccctataaccttccatgcgccc
tacagtgaactcgccaactcccgcttcacagggaaggcccttgacaaccgtataggctgc
cttgtaatggttgaggtcctaaagagggttgaaaccggtgcaaccgtttatggtgttgga
acggtccaggaggaggttggtctcaagggtgccaagacctcagcattcaggctcaacccg
gacatgaccctggccctggatgttacaatagccggggatcatccagggatgaaggaggag
gaggcccctgcgaagctcgagggcggacccgccataatcctcaccgatgccagtggcagg
ggtataataacccatccacgtgtgaaggactggctacttgagactgcacgtgaggaggac
atacctgtccagatagaggtgagtgaggggggtacaaccgatgcaaccgccattcatctc
acaagggaggggatacccgcaggcgtggtctctgtgcctacaaggtacatccatacaacg
gtgagcatggcaagcatgaaggacatcgagatgaccgttgatctccttgttaaggcaatt
gaaagattgtaa

DBGET integrated database retrieval system