KEGG   Methanothermobacter thermautotrophicus: MTH555Help
Entry
MTH555            CDS       T00009                                 

Definition
magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTH555
Enzymes [BR:mth01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MTH555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(501088..501636)
Genome map
AA seq 182 aa AA seqDB search
MVDISGSMFSDRKAARVKGLIERFIEDAQRHRDRISVVGFRGRDARVIIPSTAHASSFRD
AVESIRVGGTTPMAQGIQRGLEILREEKRHGEYVPFMVILSDGMPNVGTGRDPKREAVEA
ASRLREEEIPSTVINFERGSRGGRDLNMEIALASGGSYYDLHDLRDPSGAVAKIMEHERA
MF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgatataagcggctcaatgttctctgacaggaaggctgcaagggtcaagggcctc
atagagaggtttatagaggatgcccagaggcacagggaccgtataagtgtcgttggcttc
aggggcagggacgccagggtaataataccctcaactgcccatgcatcctccttcagggat
gctgtggagagcataagggtcggtgggacaacacccatggcccagggcatacagaggggt
cttgagatactccgggaggagaagaggcacggggagtacgtcccattcatggtcatactc
agtgatggcatgcccaatgtggggaccgggagggacccaaagagggaggccgttgaggcc
gcctcaaggctgagggaagaggagataccctcaaccgtgataaactttgagaggggatcc
cggggtggaagggacctcaacatggagatagcgctggcttcaggcggcagctactatgac
ctccatgacctcagggacccatcaggtgctgttgctaagataatggagcatgagagggcc
atgttttag

DBGET integrated database retrieval system