KEGG   Methanothermobacter thermautotrophicus: MTH556Help
Entry
MTH556            CDS       T00009                                 

Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(501904..503091)
Genome map
AA seq 395 aa AA seqDB search
MKNLIFPFTAIVGQEKVKKALILNAINPGIGGVLIKGDKGTGKTTAVRALADLLPSLRTV
KGCPFNCDPDEPEGACDMCRGGDVDVEYRKMRVVELPLGATEDRVVGSLDISKALTEGIK
ALEPGILAEANRNILYVDEINLLDDHLVDVLLDAAAYGVNTVEREGISLQHPSRFILVGT
MNPAEGELRPQLSDRIGIHINVETVTDIKQRVLIMKRRDEFEDDPEGFVERFAESQSSLR
DRIMAARKLLPAVTIDDDLLELIARVCVDAGVDGHRSDIAIVRTSKAIAAFNGRRRVREE
DVEDAIVLVLGERIPGRSYNRENTRREMQRAREEMERERESEEDQGNSDSSSGGEGSGGS
EGEESGQESGASSRGEASGSGASASLAGLSAEGSL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccttatttttccattcacagccatagtaggacaggaaaaggttaaaaaggcc
cttatactcaacgcaataaacccggggataggtggtgtcctcatcaagggtgataagggc
acaggtaagacaacggcggtgagggccctggcggaccttctaccatccctgaggacggtt
aagggctgccccttcaactgcgacccggatgaacctgagggggcatgtgacatgtgccgt
ggaggtgacgtggatgttgaataccgcaagatgcgggttgttgaactcccactgggggcc
acagaggaccgtgttgttggatcacttgacatcagtaaggccctcacagagggtataaag
gcccttgagcccgggatactcgcagaggccaacaggaacatactctacgtggatgagata
aacctcctggatgaccacctggtcgacgtgctcctggatgcagcggcctacggtgtcaac
acagtggagagggagggcatatccctccagcacccctcaaggttcatactcgttgggacc
atgaaccctgcagagggcgaactgaggccccagctctcagacaggataggtatacacata
aacgtggagaccgtgaccgacataaagcagcgggtcctcataatgaagaggagggacgaa
ttcgaggacgacccggagggcttcgttgagaggtttgctgaaagccagagcagtctccgc
gacaggataatggctgccaggaagcttctccctgcggtgacaatcgacgatgacctcctt
gagctgatagcaagggtctgtgttgatgccggtgttgacggccaccggtctgacattgca
atagtgaggacatcaaaggccatagcagccttcaatggaagaagaagggtccgtgaggag
gacgttgaggatgcaatagtccttgtacttggtgagagaatacccggcaggagctacaac
cgcgagaacacaaggagggagatgcagagggcccgtgaggagatggaacgtgagagagaa
tctgaggaggatcagggcaactcagacagctcttcagggggtgaaggttccgggggttct
gaaggtgaagagtcaggccaggagtcaggggcttcatctaggggtgaggcttcaggctca
ggggcttcagcttccctggccggtctatcggcagaaggctcactatga

DBGET integrated database retrieval system