KEGG   Methanothermobacter thermautotrophicus: MTH817Help
Entry
MTH817            CDS       T00009                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mth  Methanothermobacter thermautotrophicus
Brite
Enzymes [BR:mth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MTH817
Transfer RNA biogenesis [BR:mth03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MTH817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
742078..743715
Genome map
AA seq 545 aa AA seqDB search
MNTDKQGIRIMKDASRLIINGIISGEIRTRKDLERFKHRVCREMGLERFMSNSEILEHAT
PEEKKVIEGLLRKKPTRTISGVAVVAVMCQPRECPHGRCLYCPESEKAPPSYTGEEPAAL
RARMYDFHPYRQVYNRLEQLHSIGHPVDKVELIVMGGTFPSHSLCYQEWFISMCLKAMVD
FGAELRGIRVDVPEHHGYVKVEDAQRLNESSPVRCVGMTFETRPDYCREEDVDRMLGLGV
TRVELGVQTIYNYIYQRIKRGHSIRDVVESNRILRDSGVKVAMHLMPGLFSDFERDLRIF
RRIFRDPSFRPDMIKIYPCLVTRGSELYSLWERGLYKPYSTEEAVELIVEIKKMMPKWVR
TMRIQRDIPSRLIVDGVRKSNLGEMVYRRLEEEGVRCRCIRCREVGHMSRRGVRVDEDAV
TLMVEEYAATGGREFFLSQEDPENDVLVGFLRLRFPSEEAHRPEVDDKTALVRELHVYGS
MLPIGERGDAVGQHRGYGEELLARAESLAADNGMEKILVTSGIGAREYYSKFGYLKEGPY
MAKKL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgataaacaggggatcaggatcatgaaggacgcgtcacgcctcataatcaat
ggaataatttcaggtgaaataaggacaaggaaggaccttgagaggttcaagcacagggtc
tgccgtgaaatgggacttgagagattcatgagcaactctgaaatccttgaacatgcgact
ccggaggagaaaaaggttatagagggcctcttgagaaaaaaacccacaaggaccatctca
ggggttgctgtcgtcgctgtaatgtgccagccccgggaatgcccccatgggaggtgcctg
tactgtccagagagtgaaaaggcacctcccagttacactggagaggaacctgcagccctg
agggccaggatgtacgatttccacccctacaggcaggtttacaaccgcctggagcagctc
cacagcataggtcaccccgtggataaggttgaactcatagttatgggggggaccttcccc
tcccacagcctctgctaccaggagtggttcatctccatgtgcctcaaggccatggtggac
ttcggggcggaactcaggggcatcagggtggatgtgccagaacaccatggatacgtgaag
gttgaggacgcccagagactaaacgagtcctcgccggtgagatgcgttggcatgaccttc
gagacaagaccagactactgcagggaggaggacgtggacaggatgctgggcctgggagtt
accagggtcgagctgggagttcagaccatatacaactacatctaccagcggatcaagaga
ggccacagcataagggatgtggtggaatccaacaggatcctcagggactccggggtgaag
gttgccatgcacctgatgcctggcctgttctcagactttgaaagggacctgcgcatattc
aggaggatattcagggacccctccttcagaccggatatgatcaagatatatccctgcctt
gtgacccgtggcagcgaactctacagcctatgggagaggggcctctataagccctactcc
actgaggaggcggttgaacttatcgtggagataaagaagatgatgccgaagtgggtgagg
accatgaggatacagagggatattccctcacggctcatagtggacggtgtcaggaagtcc
aatctcggtgaaatggtctacaggcgcctggaggaggagggggtgaggtgcaggtgtata
aggtgccgtgaggttggacacatgtcaaggaggggtgtgagggtcgacgaggatgctgtt
accctcatggtggaggagtacgcagccaccggggggcgggagttcttcctctcccaggag
gaccctgaaaatgacgtccttgtgggtttcctgaggctgaggttcccatcagaggaggcc
caccgccccgaggtcgatgataaaacagcccttgtaagggaactgcatgtatacggttca
atgctccccataggagaaaggggagatgccgttggtcagcacaggggctacggtgaggag
ctacttgcaagggcagagtccctggctgctgataatggaatggagaagatacttgtaaca
agtgggataggtgcccgtgaatactacagcaaattcggatacctgaaggagggcccctac
atggcaaagaaactttag

DBGET integrated database retrieval system