KEGG   Methanothermobacter thermautotrophicus: MTH868Help
Entry
MTH868            CDS       T00009                                 

Definition
agmatine ureohydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mth  Methanothermobacter thermautotrophicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MTH868
Enzymes [BR:mth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MTH868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790203..791063)
Genome map
AA seq 286 aa AA seqDB search
MLIHTHEPLKFAFSTTDHERIPELSFGIMGVPFDSTTSYVPGARFGPMAVREASYSFEAY
NLRFSENVKVKSFDFGDLEVSPGNFMKTAGFIGDSVSEVLDMGLKPLIIGGEHTVTLPVI
ENLPEHDSLTVVHLDAHMDLADTYAGERYSHATVMRRVHELGAEIIQIGIRSASSEEAEF
AGEEGVRFCMAHEVMGDPAGAIELIDGIRGPVYISVDMDVLDPAYAPSVGNPAPAGLTPH
IMEELVLALSGKDVVGLDVVEVASGGMADPTSVNAAKIIYDILTLL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgcttatccacacccatgagcccctcaaatttgctttttccaccacagaccatgaaagg
atcccggaactctcctttggaataatgggggtcccctttgattccacgacaagctatgtg
ccgggggcacgtttcggaccaatggctgtcagggaggcatcatacagctttgaagcatac
aacctgcgtttttcagagaatgtgaaggttaaaagttttgattttggagaccttgaggtt
tcccctggcaacttcatgaagacagcgggtttcataggggactctgtgtctgaagtcctg
gatatgggccttaaaccactcataattggcggtgagcatacggtcaccctccccgtgatc
gagaatctgcctgaacatgattccctgacagtggttcacctggatgcccacatggacctg
gcagatacctacgccggagaaaggtactcacatgccaccgtcatgaggagggtccatgag
cttggagccgagataatacagataggtattagatcagcatcatcggaggaggcggaattt
gcaggggaggagggtgtcaggttctgcatggcccatgaggtcatgggggaccctgccggt
gccattgaactcatagatggtatccggggcccggtctacatttcggtggacatggatgtc
cttgaccctgcctatgctccatctgtgggtaacccggcacctgccggactcacaccccac
atcatggaggaacttgtcctcgcactctcaggtaaggatgtggtgggccttgatgtggtt
gaggtcgcatcgggtggcatggctgacccaacatctgtaaacgcagccaaaataatctac
gacattctaacactcctctga

DBGET integrated database retrieval system