KEGG   Microbulbifer thermotolerans: A3224_05150Help
Entry
A3224_05150       CDS       T04393                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00071  Fatty acid degradation
mthd00072  Synthesis and degradation of ketone bodies
mthd00280  Valine, leucine and isoleucine degradation
mthd00310  Lysine degradation
mthd00362  Benzoate degradation
mthd00380  Tryptophan metabolism
mthd00620  Pyruvate metabolism
mthd00630  Glyoxylate and dicarboxylate metabolism
mthd00640  Propanoate metabolism
mthd00650  Butanoate metabolism
mthd00900  Terpenoid backbone biosynthesis
mthd01100  Metabolic pathways
mthd01110  Biosynthesis of secondary metabolites
mthd01120  Microbial metabolism in diverse environments
mthd01130  Biosynthesis of antibiotics
mthd01200  Carbon metabolism
mthd01212  Fatty acid metabolism
mthd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mthd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3224_05150
   00630 Glyoxylate and dicarboxylate metabolism
    A3224_05150
   00640 Propanoate metabolism
    A3224_05150
   00650 Butanoate metabolism
    A3224_05150
  Lipid metabolism
   00071 Fatty acid degradation
    A3224_05150
   00072 Synthesis and degradation of ketone bodies
    A3224_05150
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3224_05150
   00310 Lysine degradation
    A3224_05150
   00380 Tryptophan metabolism
    A3224_05150
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3224_05150
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3224_05150
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A3224_05150
Enzymes [BR:mthd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3224_05150
Exosome [BR:mthd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3224_05150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AMX04066
UniProt: A0A143HRC3
Position
1229074..1230264
Genome map
AA seq 396 aa AA seqDB search
MSDVTSDPVVIVGMARTPMGAMQGGLSEVSAPELGSVAIRAALEDAGVAPADVDEVLMGC
VLPAGVGQAPARQASIRAGVPEGTPCTTVNKVCGSGMKTVMMARDALLLGEGRVIVAGGM
ESMTNAPYLLPKARGGMRLGHGEVKDHMFLDGLENAYDGKLMGNFAENTADKYGFTREEQ
DAFALESLARAQKAIESGVFEREIAPVTISTRRGDVQVRVDEGPGNARPDKIPQLKPAFR
KDGTVTAANASSISDGAAALVLMRRSEAERRGLKVLAVLRGQAQFAHQPEWFTTAPVGAM
QKLLERTGWSVDEVDLFEINEAFAVVAMAAMRELNLPHDKVNVNGGACALGHPLGASGAR
ILVTLLAAMEKRDVKRGIASLCIGGGEATAVAIERA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtaacttcagatccggtagtcatagtcggaatggcgcggacgccgatgggc
gccatgcagggaggactgtcggaggtcagcgcgccggagttgggctctgtggccatccgc
gcggcgctcgaggatgcgggtgtggcgccggcggacgtcgatgaagtgctgatgggttgc
gttttgcccgccggtgtggggcaggctcccgcgcgtcaggcatctatccgtgcgggagtt
cccgaaggcaccccctgtactactgtcaacaaggtgtgcggttcgggcatgaaaaccgtg
atgatggcccgggatgccttgttgctgggcgagggtagggtgattgtcgctggcggcatg
gagagcatgaccaacgctccctaccttttgccaaaggcccgtggtggcatgcgactgggc
cacggtgaggtaaaagaccatatgttcctggacggtctggagaatgcctacgatggcaag
ttgatgggtaacttcgccgagaataccgcggacaagtatgggttcacccgcgaggagcag
gatgcctttgcgctggaatccctggcccgggcgcaaaaggccatagagagcggtgtcttt
gaacgcgaaatagcgccggtgactatttccactcgccgcggtgatgtacaggttcgcgtg
gacgaagggccgggcaatgcgcgtccggacaaaatccctcagctgaaacccgcattccgc
aaggacggcactgtcaccgccgccaatgccagctctatctccgatggcgccgcggccctg
gtgctgatgcgccggagcgaggccgagcggcgcggcctgaaggtgctggcagtattgcgc
ggccaggcccagttcgcgcaccagccggagtggtttaccactgcccctgtgggggccatg
cagaagctgttggagcgcacgggctggagtgtggatgaagtggacttgttcgagatcaac
gaggccttcgctgtggtggccatggcagcgatgcgtgagttgaacctgccgcacgacaag
gtcaacgtcaacggtggtgcctgcgcactgggccacccgctgggcgccagtggtgctcgt
atactggtcactcttttggcggcgatggaaaagcgcgatgtgaagcgaggaattgccagc
ctgtgcatcggtggcggtgaggcgactgcggtcgcgattgagcgggcctga

DBGET integrated database retrieval system