KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_03210Help
Entry
MRGA423_03210     CDS       T01994                                 

Definition
uroporphyrin-III C-methyltransferase HemD
Orthology
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MRGA423_03210
Enzymes [BR:mti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MRGA423_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
603275..604378
Genome map
AA seq 367 aa AA seqDB search
MGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVVALIGTDLPPVSGPAPAEPVAGNGD
AAGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEARSGVDVVRLVAGDPLTVD
AVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVADVRIDPENTDWDALAAA
PGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVETTLQGLTDPAVLGA
TDPACSANGRDSQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLVPRTKDQAGEMSERL
HVVRRAAGGGADHRRRAAAQPRADGARRQGPGRWPIPVDRVHLHQRGACGVGEGSASSVW
MPARSPG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgggctccggtccgggcgaccccggcttgcttacgacacgggctgccgcggtgctggcc
aacgccgcgctggtgttcaccgatcccgacgtaccggagccggtggtggcgctgatcggc
acggatctgccccccgtgtccggcccggcgcccgccgagccggttgccgggaacggcgat
gcggccggcggaggaagtgcgcaggaacacggccgggccgcgtccgcggtagtctccggt
ggtcctgacatccgcccggcgctgggcgatcccgccgatgtggccaagacgctgaccgcc
gaggcccgttcgggtgtcgacgtggtgcggctggtggcgggcgatccgctcacggtggat
gcggtaatcagcgaggtgaacgccgtcgcacgcacccacctgcacatcgaaatcgtgccc
ggcctggccgccagcagcgcggtcccgacctatgccgggttgccgctgggttcgtcgcac
accgtcgccgacgtgcgtatcgaccccgaaaacaccgactgggacgcgctggctgccgca
cccgggccgctgatcctgcaggccaccgcatcgcatctagccgaatcggcccgcagcctg
atcgatcaccagctggccgagtccactccgtgcgtggtgaccgcacacggcaccacctgt
cagcagcgttcggtcgagaccacacttcagggattgaccgacccggccgtcctgggcgct
accgaccccgcgtgctccgcaaacgggagggactcccaggccggaccgctgatagtgacc
atcggcaagacggtgaccagtcgggcaaagctgaactggtgggagagccgcgccctctac
ggctggacggtgttggtgccgcgcaccaaggaccaggccggcgagatgagcgagcggctc
cacgtcgtacggcgcgctgccggtggaggtgccgaccatcgccgtcgagccgccgcgcag
ccccgcgcagatggagcgcgccgtcaagggcctggtcgatggccgattccagtggatcgt
gttcacctccaccaacgcggtgcgtgcggtgtgggagaaggttcggcgagttcggtctgg
atgcccgcgcgttctccggggtga

DBGET integrated database retrieval system