KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_05390Help
Entry
MRGA423_05390     CDS       T01994                                 

Definition
fatty oxidation protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRGA423_05390
   01212 Fatty acid metabolism
    MRGA423_05390
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRGA423_05390
   00650 Butanoate metabolism
    MRGA423_05390
  Lipid metabolism
   00071 Fatty acid degradation
    MRGA423_05390
   01040 Biosynthesis of unsaturated fatty acids
    MRGA423_05390
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRGA423_05390
   00310 Lysine degradation
    MRGA423_05390
   00380 Tryptophan metabolism
    MRGA423_05390
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRGA423_05390
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRGA423_05390
   00281 Geraniol degradation
    MRGA423_05390
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MRGA423_05390
Enzymes [BR:mti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MRGA423_05390
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRGA423_05390
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MRGA423_05390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
956973..959135
Genome map
AA seq 720 aa AA seqDB search
MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASA
KKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAK
AKEIGLVDELVATVEELVPAAKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAA
ILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEA
AAKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAADFKGVDFVIEAVFENQELKH
KVFGEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGS
QAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWPGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDEGVLTSTA
DANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVARARELAAAYGDRFLPPESLLS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaacacaatccagtgggacaaggatgccgacggcatcgtcacgctgaccatg
gacgatccctccgggtcaaccaacgtgatgaacgaggcctacatcgagtcgatgggcaag
gccgtcgatcgccttgtcgccgaaaaggattcgatcaccggagtggtagtcgccagcgcg
aagaaaaccttcttcgccggcggcgacgtcaagacgatgatccaggccaggcccgaggac
gccggcgatgtattcaacaccgtcgagaccatcaagcggcagctgcgcaccttggagaca
ttgggtaagccggtcgtcgcggccatcaacggggcggcgttgggcggcggcctggagatc
gcgctggcgtgtcatcaccggatcgccgccgacgtcaagggcagccagctcggtctgccg
gaggtgacgctgggtctgctgccgggtggcggtggggtgacccgcacggtacggatgttc
ggcatccagaacgcgttcgtgagcgtgctggcgcaaggtacccggttcaagccggccaag
gccaaggagatcggtctggtcgacgagctggtggcaacggtcgaggagctggtgcccgcc
gccaaggcttggataaaggaggagctcaaggccaaccccgacggtgccggggtgcagccg
tgggacaagaagggctacaagatgcccggcggcaccccgtcgtcgccgggtctggcggcg
attttgccgtcgttcccgtcgaacctgcgcaagcagctcaagggtgccccgatgccggcg
ccgcgggccatcctggccgccgcggtcgagggggcacaggtcgacttcgacaccgccagc
cgcatcgagagccgctacttcgcgtcgttggtcaccggccaggtcgccaagaacatgatg
caggcgttcttcttcgacctgcaggccatcaatgccggcgggtctcggcccgaaggcatc
ggcaagaccccgatcaagaggatcggtgtgctgggtgcgggcatgatgggcgccggcatc
gcctacgtctctgccaaggccggctatgaggtggtactcaaagatgtcagccttgaggcc
gccgctaaaggcaagggctactccgaaaagctggaggccaaggcgctggagcggggccgc
accacacaggagcgcagcgacgccctgctggcgcgcatcaccccgaccgccgacgccgcc
gatttcaagggcgttgatttcgtgatcgaggcggtttttgaaaaccaggagctcaagcac
aaggtgttcggcgagatcgaagacatcgtcgagcccaacgcgatcctgggatccaacacc
tcgacgctgccgatcaccggtctggcgaccggcgtcaagcggcaggaagactttatcggg
atccacttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acttctgacgaggccctggcccgggtgttcgactacaccttggccatcggcaagaccccg
atcgtggtcaacgacagccgcggctttttcacctcgcgggtcatcggcacgttcgtcaac
gaggcgctggcgatgctcggtgagggtgtcgagccggcttctatcgagcaggcggggtcg
caggccgggtatccggcgccgccgctgcagctgtccgacgagctcaacttggagctgatg
cacaagatcgccgtcgccacccgtaagggtgttgaggacgccggcggcacgtaccagccg
catccggcggaggccgtggtggagaagatgatcgagctcggccggtccggccggctgaag
ggcgcgggcttctacgagtacgccgacggcaagcgatccgggttgtggcccggcttgcgc
gagacgttcaagtcgggctcgtcgcagccgccgctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggaaacccagaagtgcctcgacgagggggtgctgacgtcgacggcc
gacgccaacatcggctcgatcatgggcatcggcttcccgccgtggacaggtggcagtgcc
cagttcatcgtcggctactccggcccggccggtaccggtaaggcggctttcgtggcccgg
gcccgcgagctggcggccgcctacggcgaccgcttcctgccgccggagtcgctgctaagc
tga

DBGET integrated database retrieval system