KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_06815Help
Entry
MRGA423_06815     CDS       T01994                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mti00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1216474..1216929
Genome map
AA seq 151 aa AA seqDB search
MGTNLPTEVGQILSAPTSIDYNYPTTGVWDASYDICLDSTPKTTGVNQQEIMIWFNHQGS
IQPVGSPVGNTTIEGKNFVVWDGSNGMNNAMAYVATEPIEVWSFDVMSFVDHTATMEPIT
DSWYLTSIRAGLEPWSDGVGLGVDSFSAKVN
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaccaacctgcctactgaggtgggccagattttgtcggcgccgaccagcatcgac
tacaactacccgacgaccggggtatgggacgcctcctacgacatctgcctggattccaca
cccaagacgaccggggtcaaccagcaggagatcatgatctggttcaaccaccagggctcc
attcagccggtcggctccccggtgggcaacaccaccatcgagggcaagaacttcgtggtg
tgggatggcagcaacggcatgaacaacgcgatggcctatgtcgcgaccgagccgatcgag
gtctggagcttcgacgtgatgagtttcgtcgaccacaccgccaccatggagccgatcacc
gactcgtggtacctcacgagcatccgggccggcttggagccctggagcgacggtgtgggt
ctgggggtcgattcgttctcggcgaaagtcaactaa

DBGET integrated database retrieval system