KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_09230Help
Entry
MRGA423_09230     CDS       T01994                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
mti00071  Fatty acid degradation
mti00280  Valine, leucine and isoleucine degradation
mti00281  Geraniol degradation
mti00310  Lysine degradation
mti00360  Phenylalanine metabolism
mti00362  Benzoate degradation
mti00380  Tryptophan metabolism
mti00410  beta-Alanine metabolism
mti00627  Aminobenzoate degradation
mti00640  Propanoate metabolism
mti00650  Butanoate metabolism
mti00903  Limonene and pinene degradation
mti00930  Caprolactam degradation
mti01100  Metabolic pathways
mti01110  Biosynthesis of secondary metabolites
mti01120  Microbial metabolism in diverse environments
mti01130  Biosynthesis of antibiotics
mti01212  Fatty acid metabolism
Module
mti_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mti00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRGA423_09230
   00650 Butanoate metabolism
    MRGA423_09230
  Lipid metabolism
   00071 Fatty acid degradation
    MRGA423_09230
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRGA423_09230
   00310 Lysine degradation
    MRGA423_09230
   00360 Phenylalanine metabolism
    MRGA423_09230
   00380 Tryptophan metabolism
    MRGA423_09230
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRGA423_09230
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRGA423_09230
   00281 Geraniol degradation
    MRGA423_09230
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRGA423_09230
   00627 Aminobenzoate degradation
    MRGA423_09230
   00930 Caprolactam degradation
    MRGA423_09230
Enzymes [BR:mti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRGA423_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFE12744
Position
1660921..1661778
Genome map
AA seq 285 aa AA seqDB search
MPHRCAAQVVAGYRSTVSLVLVEHPRPEIAQITLNRPERMNSMAFDAMVPLKEALAQVSY
DNSVRVVVLTGAGRGFSSGADHKSAGVVPHVENLTRPTYALRSMELLDDVILMLRRLHQP
VIAAVNGPAIGGGLCLALAADIRVASSSAYFRAAGINNGLTASELGLSYLLPRAIGSSRA
FEIMLTGRDVSAEEAERIGLVSRQVPDEQLLDACDAIAARMAGFSRPGIELTKRTLWSGL
DAASLEAHMQAEGLGQLFVRLLTANFEEAVAARAEQRAPVFTDDT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaccgctgcgcggcgcaagtcgtcgccgggtaccgttcaacggtgagtttggtc
ctcgtcgaacacccgcggcccgagatcgcgcagattaccctcaaccggccggagcggatg
aactccatggcattcgatgccatggtgccgctcaaagaggccttagcgcaggtcagctac
gacaactcggtgcgggtggtggtgctgaccggcgcgggtcgagggttttcttcgggtgcg
gatcacaagtcggcgggggtggtgccgcacgtcgagaacttgactcggcccacctacgcg
ctgcgttcgatggagctcctcgatgacgtcatcttaatgctgcgacggctgcaccagccg
gtgatcgccgcggtcaacggccccgccatcggtggtgggctgtgcctggcactggctgca
gacattcgggtggcctcgagtagcgcctacttccgggccgccggtatcaacaacgggctg
accgccagcgaattggggctgagctacctgttgcccagggccattggatcctcacgtgcg
ttcgagatcatgttgaccggtcgcgacgtcagcgccgaggaagccgagaggatcgggctg
gtatcccgtcaggtacccgatgaacagctgctagatgcctgcgacgcgatcgccgcacgg
atggcgggattctcgcggccgggaattgagttgaccaaacgtacgctgtggagtggactg
gacgccgccagtctggaggcgcacatgcaggccgagggcttggggcagctcttcgtccgg
ctgctcaccgccaacttcgaagaagcggttgccgcacgggccgagcagcgggcgccggtg
ttcaccgatgacacgtaa

DBGET integrated database retrieval system