KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_11345Help
Entry
MRGA423_11345     CDS       T01994                                 

Definition
membrane-bound C-5 sterol desaturase erg3
Organism
mti  Mycobacterium tuberculosis RGTB423
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2055948..2056850
Genome map
AA seq 300 aa AA seqDB search
MRDPVLFAIPCFLLLLILEWTAARKLESIETAATGQPRPASGAYLTRDSVASISMGLVSI
ATTAGWKSLALLGYAAIYAYLAPWQLSAHRWYTWVIAIVGVDLLYYSYHRIAHRVRLIWA
THQAHHSSEYFNFATALRQKWNNSGEILMWVPLPLMGLPPWMVFCSWSLNLIYQFWVHTE
RIDRLPRWFEFVFNTPSHHRVHHGMDPVYLDKNYGGILIIWDRLFGSFQPELFRPHYGLT
KRVDTFNIWKLQTREYVAIVRDWRSATRLRDRLGYVFGPPGWEPRTIDKSNAAASLVTSR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacccggtactgttcgccattccatgttttctattgctgctgattctcgaatgg
acggcggcccgcaagctggaaagcatcgagaccgctgctaccgggcagccacggcccgcc
tcgggcgcttacctcacccgcgactcggtggccagcatctcgatggggctggtttcgata
gccaccaccgccggctggaagtcccttgccctgctcggttatgccgcaatctatgcctac
cttgccccctggcagctgtccgcccaccggtggtacacctgggtgatcgcgatcgttggt
gtcgatctgctgtactactcctatcaccgcatcgcccaccgagttcggctgatctgggct
acccaccaggcgcatcactccagcgaatacttcaacttcgccaccgcgctgcgccagaag
tggaacaacagcggcgagattctcatgtgggttccgctgccactgatggggcttccccct
tggatggtgttctgcagttggtcgctgaacttgatctaccagttctgggtgcacaccgag
cggatcgacaggctgccgcggtggttcgaattcgtcttcaataccccgtcgcaccaccgg
gtccaccacggaatggacccggtgtatctggacaagaactatggcggcatcctcatcatc
tgggaccgcctgttcggtagctttcagccggagctattccgaccgcattatggcctgacc
aagcgggtcgacacgttcaacatctggaagctgcagacccgcgagtacgtggcgatcgtg
cgtgactggcggtcggcaacacgtctgcgggatcggctgggctacgtcttcggaccgccg
ggctgggaaccgcgcaccatcgataaatccaatgccgccgcctccctggtcacgtctcgg
taa

DBGET integrated database retrieval system