KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_13245Help
Entry
MRGA423_13245     CDS       T01994                                 

Definition
monophosphatase CYSQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mti00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MRGA423_13245
Enzymes [BR:mti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MRGA423_13245
Transfer RNA biogenesis [BR:mti03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MRGA423_13245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2392100..2392903)
Genome map
AA seq 267 aa AA seqDB search
MVSPAAPDLTDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRR
LQAERPGDAVLSEEAHDDLARLKSDRVWIIDPLDGTREFSTPGRDDWAVHIALWRRSSNG
QPEITDAAVALPARGNVVYRTDTVTSGAAPAGVPGTLRIAVSATRPPAVLHRIRQTLAIQ
PVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQL
DPYLPDLLMCRAEVAPILLGAIADAWR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagccctgccgcacctgatctgacggacgacctgactgacgccgagctggccgcc
gacctggcggcggacgcgggaaagctgttgctccaggtgcgtgcggagatcggtttcgat
cagccatggacgctcggggaagccggtgaccgccaggctaactcgctgctgttgcgacgg
ctgcaggccgaacggccgggtgacgcagtgctcagtgaggaggcccacgacgatctggcc
cggctgaaatccgatcgggtgtggattattgacccgttggatggcacccgcgagttctcc
acaccgggtcgcgacgactgggcggtacacattgcgctgtggcggcgttcctccaatggc
cagcccgagatcaccgacgccgcggtggcgttgccggcccgtggcaacgtggtgtaccgc
accgatacggtgacttccggcgccgcgccggccggcgttcctggcaccttgcggattgcc
gtcagcgccacccggccaccggcagtcctgcaccgcatccgccagacgctggcgatccaa
ccggtgtcgatcggttcggcgggcgccaaagcgatggccgtcattgacggctacgtcgac
gcctacctgcacgccggaggccaatgggagtgggattccgcggcgccggctggggtgatg
ttggccgccggcatgcacgcgtcacgactcgatggctcgccgctgcgatacaaccaactg
gacccctacctgccggatctgctgatgtgtcgagccgaggtggcgccgatcctgctcggt
gccatcgccgacgcgtggcgctga

DBGET integrated database retrieval system