KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_15205Help
Entry
MRGA423_15205     CDS       T01994                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mti01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mti00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2736924..2738054)
Genome map
AA seq 376 aa AA seqDB search
MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVIVSSGA
IAAGIEPLGLSRRPKDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRV
QHTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDID
GLYDCDPRKTADATFIPEVSGPADLDGVVAGRSSHLGTGGMASKVSAALLAADAGVPVLL
APAADAATALADASVGTVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSL
LAAGITAVSGRFCGGDVVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVV
HADDLVAVSAKQAKQV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtccgcatcgggacgcaatccggaccgcgcgcggccttgtcgtgaaggtcggg
accacggcgcttaccacaccgtccgggatgttcgatgccggccggctggccggactggcc
gaggcggtcgagcggcggatgaaggcgggttccgacgtcgtcatcgtgtcttcgggcgcc
atcgccgccggcatcgagccgctcgggctgtcccgtcgtcccaaagatctggcgaccaag
caggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagcgcggcgttcgcc
cgctacggccgcacggtgggccaggtgctgctgaccgcgcacgacatttcgatgcgggtg
cagcacaccaacgcccaacgcacgctggatcggctgcgcgcgttgcacgcggtggcgatt
gtcaacgagaacgacaccgtggccaccaacgagatccggttcggtgacaacgatcggctg
tctgcactggtggcgcacctggtcggcgccgacgctttggtgctgctgtcggacatcgac
ggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcattccggaggtgtcc
gggccggcggatctggacggtgtggtcgccggccgcagtagccacctgggtactggcggc
atggcgtccaaggtgtcggcggcgctgttggccgccgacgccggggtgccggtactgctg
gcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggcacggtgtttgcg
gcccggcccgcgcgtctgtcggcccggcggttctgggtgcgttatgccgccgaagcaacc
ggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaacgccggtcactg
ctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgatgtggtcgaactg
cgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgacgcgtccgagctg
gccaccatggtgggccggtccacctctgagctacccggcgagctgcgccgcccggtggtg
cacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtttag

DBGET integrated database retrieval system