KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_17145Help
Entry
MRGA423_17145     CDS       T01994                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mti00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mti00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3067196..3067675)
Genome map
AA seq 159 aa AA seqDB search
MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGR
RNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLP
REAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtggggctgatctgggctcaagcgacatcgggtgtcatcggccgcggcggcgacatc
ccctggcgcttgcccgaggaccaggcgcatttccgggagatcaccatggggcacacgatc
gtgatgggccggcgcacatgggattcgctgccggctaaagtccggccgctgcccggccgg
cgaaatgtcgtactgagccgccaagctgactttatggccagcggggctgaggttgtcggt
tcactcgaggaggcgctgaccagcccggagacgtgggtgatcggaggcggacaagtctat
gcgctggcgctgccgtacgcgaccagatgtgaggttaccgaggtcgacatcggcctgccg
cgcgaagccggtgacgcgctggcccccgtgctggacgagacatggcggggcgagacgggg
gagtggcgcttcagccggtccgggttgcggtaccggttgtacagctaccaccgctcatga

DBGET integrated database retrieval system