KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_20850Help
Entry
MRGA423_20850     CDS       T01994                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MRGA423_20850
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRGA423_20850
   00650 Butanoate metabolism
    MRGA423_20850
  Energy metabolism
   00190 Oxidative phosphorylation
    MRGA423_20850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3698948..3699382
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system