KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_21830Help
Entry
MRGA423_21830     CDS       T01994                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MRGA423_21830
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MRGA423_21830
Enzymes [BR:mti01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MRGA423_21830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3877693..3878082
Genome map
AA seq 129 aa AA seqDB search
MTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYL
CSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDVRASGLLPRWEQTQ
RFIGEMRGT
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgcgtttccggctcggtgttcgatgtcgtcgtcgacatccgagagggctcaccg
acattcggccgatgggactcggtgctgctcgacgaccaagaccgtaggacgatctacgtc
tccgaaggcctagcgcacggcttccttgcactgcaagacaattcgacggtgatgtacttg
tgctcggcggaatacaatccgcagcgcgagcacaccatctgcgccacagatccgacgttg
gcggtcgattggccgctggtcgatggcgctgcccccagcctgtccgaccgtgatgccgct
gcgcccagcttcgaggatgtgcgcgcgtctggcctgctgcccaggtgggaacagacgcag
cggttcattggggagatgcgcggcacctag

DBGET integrated database retrieval system