KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_22235Help
Entry
MRGA423_22235     CDS       T01994                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
mti00071  Fatty acid degradation
mti00072  Synthesis and degradation of ketone bodies
mti00280  Valine, leucine and isoleucine degradation
mti00310  Lysine degradation
mti00362  Benzoate degradation
mti00380  Tryptophan metabolism
mti00620  Pyruvate metabolism
mti00630  Glyoxylate and dicarboxylate metabolism
mti00640  Propanoate metabolism
mti00650  Butanoate metabolism
mti00900  Terpenoid backbone biosynthesis
mti01100  Metabolic pathways
mti01110  Biosynthesis of secondary metabolites
mti01120  Microbial metabolism in diverse environments
mti01130  Biosynthesis of antibiotics
mti01200  Carbon metabolism
mti01212  Fatty acid metabolism
mti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mti00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRGA423_22235
   00630 Glyoxylate and dicarboxylate metabolism
    MRGA423_22235
   00640 Propanoate metabolism
    MRGA423_22235
   00650 Butanoate metabolism
    MRGA423_22235
  Lipid metabolism
   00071 Fatty acid degradation
    MRGA423_22235
   00072 Synthesis and degradation of ketone bodies
    MRGA423_22235
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRGA423_22235
   00310 Lysine degradation
    MRGA423_22235
   00380 Tryptophan metabolism
    MRGA423_22235
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRGA423_22235
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRGA423_22235
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MRGA423_22235
Enzymes [BR:mti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MRGA423_22235
Exosome [BR:mti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MRGA423_22235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AFE14637
Position
3954218..3955402
Genome map
AA seq 394 aa AA seqDB search
MAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPAHIGAMVAVKDRLNGSRNPLAH
LQQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGT
ALRTEPLAFAGRDQVNPQAGRDAAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAIQVMGKAEARQ
VPGARKALGHAYGGGSQYFSMWVVGCEKPKQAAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaagctggccgccgtactcggcaccgggcagaccaagtatgtcgccaagcgc
caagacgtttcgatgaacggtctggtgcgggaggccatcgaccgagcgctggcggattcc
ggttccaccttcgacgacatcgacgccgtcgtggtcggcaaggcgcccgacttcttcgaa
ggggtgatgatgccggagctattcatggccgacgccatgggcgcgaccggcaagccgctg
atccgggtacacaccgccggttcggttggcggatccaccggggtagtggctgccagcctg
gtgcaatccggcaaataccgccgggtcctggcattagcctgggaaaagcagtcggaatcc
aatgccatgtgggcgttgtcgattcctgtgccgttcaccaaaccggtcggtgccggtgcg
gggggatacttcgccccgcatgtccgggcctatatccgccgctcgggcgcaccggcacac
atcggtgctatggttgcggtcaaggaccggctcaacggcagccgcaacccgttggcacat
ctgcagcagcccgacatcaccctggagaaggtgatggcatctcagatgctctgggatcca
atacgtttcgatgagacgtgcccgtcgtcagacggtgcgtgcgcggttgtcgtcggcgac
gaggagatcgccgacgcgcgactggcgcaagggcatccggtggcctggattcatggcacc
gcattacgcaccgagccgctggctttcgccgggcgcgaccaggtcaacccgcaggccggc
cgcgacgcggcggcggcgctgtggaaggccgcgggcatcaccagccccatcgacgaaatc
gacgccgccgaaatttacgtcccgttctcctggttcgagccgatgtggttggagaatctg
ggatttgcccgcgagggcgagggctggaagctcaccgaggccggcgagactgcgatcggc
ggtcgactaccggtgaacccttccggcggcgtgctgtccgccaatccgatcggcgcatcg
ggcctgatccgcttcgccgaggccgcgatccaagtcatgggcaaggcggaggcgcgtcaa
gttccgggtgcgcgaaaggccttggggcacgcttacggtggcggctcgcagtacttctct
atgtgggtggtcggctgcgagaaacccaaacaggcagccgcataa

DBGET integrated database retrieval system