KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_05060Help
Entry
J112_05060        CDS       T02616                                 

Definition
ATP-dependent DNA ligase (EC:6.5.1.1)
Orthology
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mtj00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    J112_05060
Enzymes [BR:mtj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     J112_05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1046045..1048324
Genome map
AA seq 759 aa AA seqDB search
MGSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQ
PAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAE
PGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHLY
TPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAP
YSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAPVADRLTRY
RRMRDASKTPEPIPTAKPVTGDGNTFVIQEHHARRPHYDFRLERDGVLVSWAVPKNLPDN
TSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSGTYDTEKFHDDPHTGEVIVNL
HGGRISGRYALIRTNGDRWLAHRLKNQKDQKVFEFDNLAPMLATHGTVAGLKASQWAFEG
KWDGYRLLVEADHGAVRLRSRSGRDVTAEYPQLRALAEDLADHHVVLDGEAVVLDSSGVP
SFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLETLANATSLTVPELLPGDG
AQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNTQEVVIGGWRAGEGGRSSGV
GSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLHTDESPFDVPLPARDAKGITYV
KPALVAEVRYSEWTPEGRLRQSSWRGLRPDKKPSEVVRE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgtcggagcaacgggtgacgctgaccaacgccgacaaggtgctctatccc
gccaccgggaccacaaagtccgatatcttcgactactacgccggtgttgccgaagtcatg
ctcggccacatcgcgggacggccggcgacgcgcaagcgctggcctaacggcgtcgaccaa
cccgcgttcttcgaaaagcagttggcgttgtcggcgccgccttggctgtcacgtgcaacg
gtggcgcaccggtccgggacgacgacctatccgatcatcgatagcgcaaccgggctggcc
tggatcgcccaacaggcggcgctggaggtgcacgtgccgcagtggcggtttgtcgccgag
cccggatcaggtgagttaaatccgggcccggcaacgcgtttggtgttcgacctggacccg
ggcgaaggcgtgatgatggcccagctggccgaggtggcgcgcgcggttcgtgatcttctc
gccgatatcgggttggtcaccttcccggtcaccagcggcagcaagggattgcatctgtac
acaccgctggatgagccggtgagcagcaggggagccacggtgttggccaagcgcgtcgcg
cagcgattggagcaggcgatgcccgcgttggtcacctcgaccatgaccaaaagcctgcgg
gccgggaaggtgtttgtggactggagccagaacagcggctcgaagaccaccatcgcgccg
tactcactacgtggccggacgcatccgaccgtcgcggcgccacgcacctgggcggagctc
gacgaccccgcactgcgtcagctctcctacgacgaggtgctgacccggattgcccgcgac
ggcgatctgctcgagcggctggatgccgacgctccggtagcggaccggttgacccgatac
cgccgcatgcgcgacgcatcgaaaactcccgagccgattcccacggcgaaacccgttacc
ggagacggcaatacgttcgtcatccaggagcatcacgcgcgtcggccgcactacgatttc
cggctggaacgcgacggcgtgctggtctcgtgggcggtaccgaaaaacctgcccgacaac
acatcggttaaccatctagcgatacacaccgaggaccacccgctggaatacgccacgttc
gagggcgcgattcccagcggggagtacggcgccggcaaggtgatcatctgggactccggc
acttacgacaccgagaagttccacgatgacccgcacacgggggaggtcatcgtgaatctg
cacggcggccggatctctgggcgttatgcgctgattcggaccaacggcgatcggtggctg
gcgcaccgcctaaagaatcagaaagaccagaaggtgttcgagttcgacaatctggcccca
atgcttgccacgcacggcacggtggccggtctaaaggccagccagtgggcgttcgaaggc
aagtgggacggctaccggttgctggttgaggctgaccacggcgccgtgcggctgcggtcc
cgcagcgggcgcgatgtcaccgccgagtatccgcaattgcgggcattggcggaggatctc
gccgatcaccacgtggtgctggacggcgaggccgtcgtacttgactcctctggtgtgccc
agcttcagccagatgcagaatcggggccgcgacacccgtgtcgagttctgggcgttcgac
ctgctctacctcgacggccgcgcgctgctaggcacccgctaccaagaccggcgtaagctg
ctcgaaaccctagctaacgcaaccagtctcaccgttcccgagctgctgcccggtgacggc
gcccaagcgtttgcgtgctcgcgcaagcacggctgggagggcgtgatcgccaagaggcgt
gactcgcgctatcagccgggccggcgctgcgcgtcgtgggtcaaggacaagcactggaac
acccaggaagtcgtcattggtggctggcgcgccggggaaggcgggcgcagcagtggcgtc
gggtcgctgctcatgggcatccccggtccaggtgggctgcagttcgccgggcgggtcggt
accggcctcagcgaacgcgaactggccaacctcaaggagatgctggcgccgctgcatacc
gacgagtcccccttcgacgtaccactgcccgcgcgtgacgccaagggcatcacatatgtc
aagccggcgctggttgcagaggtgcgctacagcgagtggactccggagggccggctgcgt
caatcaagctggcgtgggctgcggccggacaagaaacccagtgaggtggtgcgcgaatga

DBGET integrated database retrieval system