KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_10210Help
Entry
J112_10210        CDS       T02616                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    J112_10210
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    J112_10210
Enzymes [BR:mtj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     J112_10210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2161370..2162566
Genome map
AA seq 398 aa AA seqDB search
MTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKT
PEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNL
SPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLAL
ARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPR
KLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGR
TILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFT
EVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacctacggagaggccgtggcggacgtgctcgaattcggtcagagcgagggcgaaccc
attggcatggctcccgaggagtggcgggcgttcgccgcgcgtgcatcgctgcatgccgcc
cgggcaaaggccaaggagctgggcgccgatccgccatgggactgcgagctggccaagacc
ccggagggctactaccagatccgcggcggcataccgtatgcgatcgccaaatcgctggcc
gcggcaccgtttgccgacattctttggatggagaccaagaccgccgatctcgccgacgct
cgacagttcgccgaggcgatccatgccgagttccccgaccagatgctggcgtacaacctc
tcaccatcgttcaactgggacaccaccggcatgaccgacgaggagatgcggcgcttcccc
gaggagctcggcaaaatgggcttcgtcttcaacttcatcacctatggcgggcaccagatc
gacggtgtcgcggccgaggaattcgccaccgcgctgcgccaggacggcatgctggcgctg
gctcggttgcagcgcaagatgcgcttggtcgaatctccctatcgcacaccgcaaacgcta
gtcggcgggccgcgcagtgacgccgcattggctgcctcctccggacgcacggcgaccacg
aaggcaatgggcaagggctccacccagcaccagcacttggtgcaaactgaggtgccgcgc
aagctgctagaggaatggctggccatgtggagcggtcactaccagctcaaagacaaactg
cgcgtacagcttcggccgcagcgggccggctcggaggtgctcgagctcggcatccacggc
gaaagcgatgacaagctcgccaacgtgatattccaaccgatccaagatcgccgcggccgc
accatcctgttggtacgcgaccagaacacgttcggtgcggaactacgccaaaagcggctg
atgaccctgatccacctctggctcgtccaccgcttcaaggcgcaggcggtgcactacgtc
acgcccaccgacgacaacctctaccagacctcgaagatgaagtcgcatggaatcttcacc
gaggtcaaccaggaggtgggcgagatcatcgtcgccgaggtgaaccacccgcgcatcgcc
gaactgctgacgcccgatcgggtggcgctgcggaagttgatcacgaaggaggcgtag

DBGET integrated database retrieval system