KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_15655Help
Entry
J112_15655        CDS       T02616                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtj03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3238289..3239158)
Genome map
AA seq 289 aa AA seqDB search
MPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPADLTARLRGARINGTDRRG
KYLWLTLNTAGVHRPTDTALVVHLGMSGQMLLGAVPCAAHVRISALLDDGTVLSFADQRT
FGGWLLADLVTVDGSVVPVPVAHLARDPLDPRFDCDAVVKVLRRKHSELKRQLLDQRVVS
GIGNIYADEALWRAKVNGAHVAATLRCRRLGAVLHAAADVMREALAKGGTSFDSLYVNVN
GESGYFERSLDAYGREGENCRRCGAVIRRERFMNRSSFYCPRCQPRPRK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaagtcgaggtggtgcggcgcggcttgcaggctcacgtgaccggc
cggaccatcaccgaggttcgggtgcaccacccccgcgctgtgcgccgccacgatgccggg
cccgcggatctgacggcgcggctgcggggagcgcggatcaacggaaccgatcggcgcggc
aagtacctgtggttgacactcaatacggctggggtccataggccgacggacaccgcactc
gtggtgcacctgggcatgagtgggcagatgctgctcggggcggtgccgtgtgccgctcac
gtccggatttccgcgctgctcgacgacgggaccgtgctgagcttcgctgaccaacggacc
ttcggagggtggctgcttgccgacctggtgacggtggacggcagcgtggtaccggtgccg
gtcgcccacctggcgcgcgacccgcttgacccgcggttcgattgtgacgctgtagttaaa
gtgttgcggcgcaagcattccgaactcaagcgccagctgctggatcagcgggtggtgtcg
ggaatcggcaacatctatgccgatgaggcgctgtggcgggccaaggtgaacggcgcccac
gtcgccgccacactaaggtgccggcgtctgggagcggtcctgcatgccgccgccgacgtg
atgcgcgaagcgctggcgaaaggtggcacctcgttcgactctttgtatgtcaacgtcaac
ggcgagtcgggctacttcgagcggtcgctggacgcttatggccgcgaaggcgaaaactgt
cggcgctgcggcgcggtgatacgccgggagaggtttatgaaccgctcgtcgttctactgc
ccgcgatgccagccgcggccccgaaagtag

DBGET integrated database retrieval system