KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_20055Help
Entry
J112_20055        CDS       T02616                                 

Definition
(RefSeq) hypothetical protein
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4180282..4181322)
Genome map
AA seq 346 aa AA seqDB search
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagctgaggaactcgacgtcgacggcatcgcggtgcggttgactagcccg
gacaggatgtatttcccgaagctggggtcgcacggcaccaagcgccgcctcgttgagtac
tacttcgccgtggccgggggtccgatgctgacggcgctgcgtgaccggccgacgcacttg
cagcgcttcccggacggcgtcgacggcgagcagatctaccaaaagcggatcccgcggcac
cgccctgactacctgcagacgtgccgggtgacgtttccgtcggggcggatggctgacgcg
ctgaaggtgacccacccggcggcgatcgtatgggcggcgcagatgggcacaatcaccctg
cacccgtggcaagtgcgctgccccgacaccgagcaccccgacgaattgcgcatcgatcta
gatccgcaaccgggcaccggcttcgtggaggcgcgtacggtcgccgtcgatgtgctccgg
tccgtgctggacgacctcggtctggtcggttatccgaagacatccgggggtagagggatt
cacgtattcctgcgcatcgccaccgactgggacttcgtcgaggtgcgtcgggcgggcatt
gcgttggcccgggaagtcgagcgccgcgcaccggatgcggtgacgacgtcgtggtggaag
gaagaacggggcgcgcgtatcttcatcgacttcaaccaaaacgcccgcgaccgcaccatg
gcgtcggcctattcggtgcgtcctaccccgatcgcgacggtatcgatgccgttgacctgg
gaagagctggccggcgcggatcccgacgactacaccatgaccacggtgcccgagctggtg
aagatccgcgacgacccctgggccggcatggacgacgtggcccagtcgattgcaccattg
ctggacttggccgccgccgacgaggagcgcgggctcggtgacatgccgtatccgccgaac
tatccgaagatgccgggcgaacccaagcgggtgcagccgagccgggataccgacttgaag
gggggaaacacgtcgaagtaa

DBGET integrated database retrieval system