KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_00225Help
Entry
TBSG_00225        CDS       T01690                                 

Definition
(GenBank) enoyl-CoA hydratase echA1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00071  Fatty acid degradation
mtk00280  Valine, leucine and isoleucine degradation
mtk00281  Geraniol degradation
mtk00310  Lysine degradation
mtk00360  Phenylalanine metabolism
mtk00362  Benzoate degradation
mtk00380  Tryptophan metabolism
mtk00410  beta-Alanine metabolism
mtk00627  Aminobenzoate degradation
mtk00640  Propanoate metabolism
mtk00650  Butanoate metabolism
mtk00903  Limonene and pinene degradation
mtk00930  Caprolactam degradation
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01120  Microbial metabolism in diverse environments
mtk01130  Biosynthesis of antibiotics
mtk01212  Fatty acid metabolism
Module
mtk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TBSG_00225
   00650 Butanoate metabolism
    TBSG_00225
  Lipid metabolism
   00071 Fatty acid degradation
    TBSG_00225
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBSG_00225
   00310 Lysine degradation
    TBSG_00225
   00360 Phenylalanine metabolism
    TBSG_00225
   00380 Tryptophan metabolism
    TBSG_00225
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBSG_00225
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBSG_00225
   00281 Geraniol degradation
    TBSG_00225
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBSG_00225
   00627 Aminobenzoate degradation
    TBSG_00225
   00930 Caprolactam degradation
    TBSG_00225
Enzymes [BR:mtk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TBSG_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: AEB02354
Structure
PDB: 

Jmol
Position
265447..266235
Genome map
AA seq 262 aa AA seqDB search
MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLADAMDQLDGDAGLSVA
ILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTKPLIAAVEGYALAGGTELALA
ADLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLPAERAHELGL
VNVLAEPGTALDAAIALAEKITANGPLAVVATKRIITESRGWSPDTMFAEQMKILVPVFT
SNDAKEGAIAFAERRRPRWTGT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaaagcgacgcagccaacaccgaacctgaggttctggtcgaacagcgggat
cggattttgatcatcacgatcaaccgcccgaaagccaagaacgcggtcaacgccgcagtc
agccggggcttggccgatgcgatggatcagcttgacggcgatgccggcctgtcggtggca
atcctgaccggtgggggcggttcgttctgcgcgggcatggacctcaaggcgttcgcccgg
ggcgagaatgtcgtcgtcgaaggtcgcggccttggctttaccgaacgtccgccgaccaag
ccgctcattgctgcggtggaaggctacgcgttggcgggtggcaccgagctggcgcttgct
gccgacctgatcgtggcggccagggattcggcgttcgggattcctgaagtcaagcggggt
ctggttgccggcggcgggggattgctgcggttgccggagcgcatcccgtatgcgatagcc
atggagttggcgctgaccggtgacaacctaccggccgaacgcgcgcacgagctggggctc
gtcaacgttttggccgagccggggaccgccctcgatgctgcgatcgcgttggcggagaag
atcaccgccaatgggccgctggcggtggtggccaccaagcggattatcaccgagtcgcgt
gggtggagtcccgacactatgttcgctgagcagatgaagatcctggtgccggtgttcacc
tccaacgacgcgaaggaaggtgcgatcgcgttcgccgagaggcgccggccccgttggacg
ggcacctag

DBGET integrated database retrieval system