KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_00523Help
Entry
TBSG_00523        CDS       T01690                                 

Definition
uroporphyrin-III C-methyltransferase hemD
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBSG_00523
Enzymes [BR:mtk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     TBSG_00523
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TBSG_00523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603054..604751
Genome map
AA seq 565 aa AA seqDB search
MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVVALIGTDLPPV
SGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEARSGV
DVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVADVR
IDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVE
TTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLV
PRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTSTNA
VRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDDFPP
YDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIKTGG
FDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGPLVD
ALAEHAARLRAEGALPPPRKKSRRR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctccggtccgggc
gaccccggcttgcttacgacacgggctgccgcggtgctggccaacgccgcgctggtgttc
accgatcccgacgtaccggagccggtggtggcgctgatcggcacggatctgccccccgtg
tccggcccggcgcccgccgagccggttgccgggaacggcgatgcggccggcggaggaagt
gcgcaggaacacggccgggccgcgtccgcggtagtctccggtggtcctgacatccgcccg
gcgctgggcgatcccgccgatgtggccaagacgctgaccgccgaggcccgttcgggtgtc
gacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtaatcagcgaggtg
aacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggccgccagcagc
gcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgccgacgtgcgt
atcgaccccgaaaacaccgactgggacgcgctggctgccgcacccgggccgctgatcctg
caggccaccgcatcgcatctagccgaatcggcccgcagcctgatcgatcaccagctggcc
gagtccactccgtgcgtggtgaccgcacacggcaccacctgtcagcagcgttcggtcgag
accacacttcagggattgaccgacccggccgtcctgggcgctaccgaccccgcgtgctcc
gcaaacgggagggactcccaggccggaccgctgatagtgaccatcggcaagacggtgacc
agtcgggcaaagctgaactggtgggagagccgcgccctctacggctggacggtgttggtg
ccgcgcaccaaggaccaggccggcgagatgagcgagcggctcacgtcgtacggcgcgctg
ccggtggaggtgccgaccatcgccgtcgagccgccgcgcagccccgcgcagatggagcgc
gccgtcaagggcctggtcgatggccgattccagtggatcgtgttcacctccaccaacgcg
gtgcgtgcggtgtgggagaagttcggcgagttcggtctggatgcccgcgcgttctccggg
gtgaagatcgcctgtgtcggcgagtcgacggccgaccgggtgcgcgccttcggaatcagt
cccgagctggtgccctccggggagcagtcctcgcttggcttgctagacgacttcccgccc
tacgacagcgttttcgacccggtgaaccgggttttgctgccgcgcgccgacatcgccacc
gaaacgctggccgagggactgcgagagcgtggctgggagatcgaggacgtcaccgcctac
cggaccgtgcgggccgcgccgccgccggccactacccgggaaatgatcaagacgggcggg
tttgacgcggtatgtttcacctccagctcgacggtgcgaaacctggtcggcatcgccggc
aagccgcacgcgcggacgatcatcgcctgcatagggccaaagaccgccgagaccgcagcc
gagttcggcttgcgggtcgatgtccagccggacaccgccgccatcggcccgctggtcgat
gcgctggccgagcatgccgcccggttgcgcgctgagggtgcgctgcccccgccgcgcaag
aagagccgcaggcgctag

DBGET integrated database retrieval system