KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_00523Help
Entry
TBSG_00523        CDS       T01690                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase hemD
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00860  Porphyrin and chlorophyll metabolism
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01120  Microbial metabolism in diverse environments
Module
mtk_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBSG_00523
Enzymes [BR:mtk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     TBSG_00523
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TBSG_00523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AEB02652
Position
603054..604751
Genome map
AA seq 565 aa AA seqDB search
MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDVPEPVVALIGTDLPPV
SGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGDPADVAKTLTAEARSGV
DVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVPTYAGLPLGSSHTVADVR
IDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAESTPCVVTAHGTTCQQRSVE
TTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTSRAKLNWWESRALYGWTVLV
PRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQWIVFTSTNA
VRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPSGEQSSLGLLDDFPP
YDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPATTREMIKTGG
FDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPDTAAIGPLVD
ALAEHAARLRAEGALPPPRKKSRRR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagggcgtaagccgagaccgggccgcatcgttttcgtgggctccggtccgggc
gaccccggcttgcttacgacacgggctgccgcggtgctggccaacgccgcgctggtgttc
accgatcccgacgtaccggagccggtggtggcgctgatcggcacggatctgccccccgtg
tccggcccggcgcccgccgagccggttgccgggaacggcgatgcggccggcggaggaagt
gcgcaggaacacggccgggccgcgtccgcggtagtctccggtggtcctgacatccgcccg
gcgctgggcgatcccgccgatgtggccaagacgctgaccgccgaggcccgttcgggtgtc
gacgtggtgcggctggtggcgggcgatccgctcacggtggatgcggtaatcagcgaggtg
aacgccgtcgcacgcacccacctgcacatcgaaatcgtgcccggcctggccgccagcagc
gcggtcccgacctatgccgggttgccgctgggttcgtcgcacaccgtcgccgacgtgcgt
atcgaccccgaaaacaccgactgggacgcgctggctgccgcacccgggccgctgatcctg
caggccaccgcatcgcatctagccgaatcggcccgcagcctgatcgatcaccagctggcc
gagtccactccgtgcgtggtgaccgcacacggcaccacctgtcagcagcgttcggtcgag
accacacttcagggattgaccgacccggccgtcctgggcgctaccgaccccgcgtgctcc
gcaaacgggagggactcccaggccggaccgctgatagtgaccatcggcaagacggtgacc
agtcgggcaaagctgaactggtgggagagccgcgccctctacggctggacggtgttggtg
ccgcgcaccaaggaccaggccggcgagatgagcgagcggctcacgtcgtacggcgcgctg
ccggtggaggtgccgaccatcgccgtcgagccgccgcgcagccccgcgcagatggagcgc
gccgtcaagggcctggtcgatggccgattccagtggatcgtgttcacctccaccaacgcg
gtgcgtgcggtgtgggagaagttcggcgagttcggtctggatgcccgcgcgttctccggg
gtgaagatcgcctgtgtcggcgagtcgacggccgaccgggtgcgcgccttcggaatcagt
cccgagctggtgccctccggggagcagtcctcgcttggcttgctagacgacttcccgccc
tacgacagcgttttcgacccggtgaaccgggttttgctgccgcgcgccgacatcgccacc
gaaacgctggccgagggactgcgagagcgtggctgggagatcgaggacgtcaccgcctac
cggaccgtgcgggccgcgccgccgccggccactacccgggaaatgatcaagacgggcggg
tttgacgcggtatgtttcacctccagctcgacggtgcgaaacctggtcggcatcgccggc
aagccgcacgcgcggacgatcatcgcctgcatagggccaaagaccgccgagaccgcagcc
gagttcggcttgcgggtcgatgtccagccggacaccgccgccatcggcccgctggtcgat
gcgctggccgagcatgccgcccggttgcgcgctgagggtgcgctgcccccgccgcgcaag
aagagccgcaggcgctag

DBGET integrated database retrieval system