KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_00837Help
Entry
TBSG_00837        CDS       T01690                                 

Definition
hypothetical protein
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(909875..910687)
Genome map
AA seq 270 aa AA seqDB search
MPMRKVLVGVTGAAIVVAVLIVGAVGADFGASIYAEYRLSTTVRKAANLRSDPFVAILRF
PFIPQAMREHYAELEIKAFAVEHAGSGTATLEATMHSIDLSYASWLIRPDAKLPVGELES
RIIIDSMHLGRYLGISDLMVAAPRQESNDATGGTTESGISGSRGLVFSGTPISANFAHRV
SVLVDLSVASDDRATLVITPTAVVTGPDTADQPVPDDKRDAVLHAFASKLPNQKLPFGVV
PNTVGARGSDVIIEGITRGVTISLDEFKQS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgcgcaaggtgctggtcggggtgaccggggcggcgatcgtcgtggccgttctc
atcgtgggcgccgtcggcgccgatttcggggccagcatctatgccgagtaccggctgtcg
accactgtgcgcaaagcggcaaacctgaggtcagacccgttcgtcgccatcctgcggttc
ccattcatcccgcaggcgatgcgggaacactacgcggagctagaaatcaaggcatttgcc
gtggagcacgccggaagtggcacggccactctggaggccactatgcattcgatcgacttg
tcctacgcgtcctggctgatcaggcccgatgccaagctcccggtcggcgagctggagagt
cgcatcatcatcgactccatgcacctgggccgctacctgggcattagcgaccttatggtc
gccgcgccccgtcaggagagcaacgacgccaccggcggcactaccgagtccgggatatct
ggcagccgcgggctggtgttcagcggcacgcccatatcggccaacttcgctcaccgggtc
agcgtcttggtggacctgtccgttgcctcggacgaccgcgcgaccttggttatcaccccc
accgccgtcgtgaccggacccgacaccgcggaccaaccggttccggatgacaagcgggat
gcggtgctgcacgccttcgccagcaagctgcccaaccagaagctgccgttcggggtggtg
ccaaacaccgtgggggcgcgcggatcggacgtcatcatcgaaggcattacccggggagta
acgatctcgctcgacgagttcaaacagtcatga

DBGET integrated database retrieval system