KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_00966Help
Entry
TBSG_00966        CDS       T01690                                 

Definition
6-phosphofructokinase pfkA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBSG_00966
   01230 Biosynthesis of amino acids
    TBSG_00966
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBSG_00966
   00030 Pentose phosphate pathway
    TBSG_00966
   00051 Fructose and mannose metabolism
    TBSG_00966
   00052 Galactose metabolism
    TBSG_00966
  Energy metabolism
   00680 Methane metabolism
    TBSG_00966
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TBSG_00966
Enzymes [BR:mtk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TBSG_00966
Protein phosphatases and associated proteins [BR:mtk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TBSG_00966
Messenger RNA biogenesis [BR:mtk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TBSG_00966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1043927..1044958
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCHARYGSSVVGFQNGFRGLLENRRVQLHNDDRNDR
LLAKGGTMLGTARVHPDKLRAGLPQIMQTLDDNGIDVLIPIGGEGTLTAASWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHERVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDIEEVCRLVKGRFQRGDSHFICVVAEGAKPAPGTIMLREGGLD
EFGHERFTGVAAQLAVEVEKRINKDVRVTVLGHIQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVTLRGQDIGRVPLADAVRKLKLVPQSRYDDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggattggagttcttaccggaggcggcgactgtcccggccttaacgccgtcatccgt
gcggtggtgcgtacctgccacgcccgatacggctcgtcggtggtcggatttcagaacggc
tttcgcgggctgctggagaaccgccgtgttcaactgcacaacgacgaccgcaatgaccgg
ctgctggccaagggcggcacgatgctgggcacggcccgggtgcaccccgacaaactgcgg
gcggggctgccccaaatcatgcagaccttggacgacaacgggatcgacgtcctgatcccg
atcggcggtgagggtacgctgaccgccgcgagttggctctccgaagagaatgtgccggtg
gtcggggtgccaaagacgatcgacaacgacatcgactgcaccgatgtgaccttcggccac
gacaccgcgttgaccgtggccaccgaggccatcgaccggctgcacagcaccgccgaatcc
cacgagcgggtgatgctggtggaggtgatgggtaggcatgccggctggatcgcgctgaac
gccgggctggcctccggtgctcacatgaccctgattcctgagcagccgttcgacatcgaa
gaggtgtgccgactggtcaaaggccgtttccagcgcggggactcgcatttcatctgcgtg
gtcgccgaaggcgccaaaccggctccggggacgatcatgctgcgcgagggtggtctcgac
gagttcgggcacgagcgtttcacaggtgtagcggcgcagctggcggtcgaggtcgagaag
cgcatcaacaaggatgtccgggtgacggtgttgggccacatccagcggggtggtactccg
accgcctacgaccgagtgctggccacccgattcggggtgaacgccgccgacgccgcgcat
gcgggcgagtacggccagatggtgacgttgcgcggccaggacatcggtcgggttccgctg
gcggatgcggttcgcaaactcaaactggtgccgcagagccgttacgacgacgccgccgcc
ttcttcggttga

DBGET integrated database retrieval system