KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_01150Help
Entry
TBSG_01150        CDS       T01690                                 

Definition
enoyl-CoA hydratase echA16
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TBSG_01150
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TBSG_01150
   00650 Butanoate metabolism
    TBSG_01150
  Lipid metabolism
   00071 Fatty acid degradation
    TBSG_01150
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBSG_01150
   00310 Lysine degradation
    TBSG_01150
   00360 Phenylalanine metabolism
    TBSG_01150
   00380 Tryptophan metabolism
    TBSG_01150
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBSG_01150
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBSG_01150
   00281 Geraniol degradation
    TBSG_01150
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBSG_01150
   00627 Aminobenzoate degradation
    TBSG_01150
   00930 Caprolactam degradation
    TBSG_01150
Enzymes [BR:mtk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TBSG_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1275751..1276500)
Genome map
AA seq 249 aa AA seqDB search
MTDDILLIDTDERVRTLTLNRPQSRNALSAALRDRFFAALADAEADDDIDVVILTGADPV
FCAGLDLKELAGQTALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASEHARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSLTGDYLSATDALRAGLVTEVVAHDQLLP
TARRVAASIVGNNQNAVRALLASYHRIDESQTAAGLWLEACAAKQFRTSGDTIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacatcctgctgatcgacaccgacgaacgggtgcgaaccctcaccctcaac
cggccgcagtcccgcaacgcgctctcggcggcgctacgggatcggtttttcgcggcgttg
gccgacgccgaggccgacgacgacatcgacgtcgtcatcctcaccggcgccgatccggtg
ttctgcgccggactggacctcaaggagctggccgggcagaccgcgctgccggacatctca
ccgcggtggccggccatgaccaagccggtgatcggcgcgatcaacggcgccgcggtcacc
ggcgggctcgaactggcgctgtactgcgacatcctgatcgcctccgagcacgcccgcttc
gccgacacccacgcccgggtgggcctgctgcccacctggggactcagcgtgcgcttgccg
caaaaggtcggcatcggcctggcccggcggatgagcctgaccggcgactacctgtccgcg
accgacgcgttgcgggccggcctggtcaccgaggtggtggcccacgaccagctgctgccc
accgcccgccgggtggcggcgtcgatcgtcggcaacaaccagaacgcggtgcgggcattg
ctggcgtcctaccaccgcatcgacgagtctcagaccgccgccgggctgtggctggaagcc
tgcgcggccaagcaatttcgcactagcggcgataccatcgccgccaaccgcgaagccgtg
ctgcagcgcggccgcgcgcaggtgcgttag

DBGET integrated database retrieval system