KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_01202Help
Entry
TBSG_01202        CDS       T01690                                 

Definition
alanine rich oxidoreductase
Orthology
K00459  
nitronate monooxygenase [EC:1.13.12.16]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Nitrogen metabolism
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mtk00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1324617..1325651
Genome map
AA seq 344 aa AA seqDB search
MVLGFWDIAVPIVGAPMAGGPSTPALAAAVSNAGGLGFVAGGYLSADRLADDIAAARAAT
TGPIGANLFVPQPSVADWAQLEYYADELEEVAEYYHTEVGQPVYGDDDDWVRKLEVVADV
RPEVVSFTFGAPPPDVVQRLSALGLLVSITVTSVYEAGVAIAAGADSLVVQGPAAGGHRG
TFAPDMEPGTESLHQLLDRIGSAHDVPLVAAGGLGTAEDVAAVLRRGAIAAQVGTALLLA
DEAGTNAAHRAALKNPEFDATLVTRAFSGRYARGLANNFTRLLDHVAPLGYPEVHQMTKP
IRAAAVQADDPHGTNLWAGSAHRKTRPGPAADIIASLTPDVCSA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgggcttctgggacatcgcggtgccgatcgtcggcgccccgatggccggcggc
ccgagcaccccggcgttggccgcggcggtgtccaacgctggcgggcttggtttcgtcgcc
ggcggctatctgagcgcggaccggctcgccgacgatatcgccgctgcgcgcgccgccact
accggtcctatcggagccaatctgtttgtgccccaacccagcgtcgccgactgggcgcag
ctggagtattacgcggacgagctcgaagaggtcgccgagtactaccacaccgaggtgggc
cagcccgtctatggtgacgacgacgactgggtgcgcaaactcgaggtggtagccgatgtt
cgtccggaggtggtgtcgttcaccttcggcgcgccgccgccggatgtcgtgcagcggttg
agcgcgctgggactgttggtctcgatcaccgtgacgtcggtctacgaggccggtgtggcc
attgccgcgggcgcggacagcctggtggtccagggcccggctgccggcgggcaccgcgga
acgttcgcgccggacatggaacccggtacggagtcgctgcaccaactcctcgatcggatt
ggcagcgcccatgatgtgccgctggttgcagccggtggcctgggcacggctgaggacgtg
gccgccgtgctgcgccgcggagcgatcgccgcgcaggttggtaccgcattgctgctggcc
gacgaagccggtaccaatgccgcacaccgtgccgcgctgaagaatccagagttcgatgcc
accctggtcactcgggcgttctcgggtaggtatgcgcgcggtctggccaacaacttcact
cgcctgctcgaccacgtggcgccgctgggttatccggaggtccaccagatgacgaagccg
atacgggcggcggcggtgcaggcggacgacccgcacggaacaaacctttgggcgggatcg
gcgcaccggaagacccggccgggacccgcggccgacatcatcgcttcccttactcccgac
gtgtgctcggcgtaa

DBGET integrated database retrieval system