KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_01539Help
Entry
TBSG_01539        CDS       T01690                                 

Definition
C4-dicarboxylate-transport transmembrane protein dctA
Orthology
K11103  
aerobic C4-dicarboxylate transport protein
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TBSG_01539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1671439..1672914)
Genome map
AA seq 491 aa AA seqDB search
MTAPLDRAPVTDLPANNKGRDRTHWLYLAVIFAVIAGVIVGLTAPSTGKSLTVLGTVFVN
LIKMMIAPVIFCTIVLGIGSVRKAAAVGKVGGLALAYFLTMSSVALGIGLIVGNLLSPGR
DLHLRPGAVGSGAALAGQAAESHGIAGFIQQIIPRSLPSALTEGNVLQVLLVALLVGFAV
QGLGPAGESILRAVENLQKLVFKVLVMVLWLAPIGAFGAIANIVATTGFNAVTNLLLLMA
GFYLTCVVFVFGVLGVLLRIVSGLSIFRLLRYLAREYLLIFATSSSEVVLPRLITKMKHL
GVQSSTVGVVVPTGYSFNLDGTAIYLTMASLFIADAMGHRLTWGEQIALLAFMIIASKGA
AGVSGAGLATLAGGLQAHRPELLDGVGLIVGIDRFMSEARSLTNFSGNAVATILVASWTK
TIDLSKADEVLRGRDPFDESTMVDPHDEEPPAATPHGGGVPTNPALCDFEQVSLGGLVGR
PAGPQRADVDG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccttggatcgtgcgccggtcacggatttgccggctaacaacaaaggccga
gaccgcacccactggctgtatctcgcggtcattttcgcagtgatagccggtgtgatcgtg
gggctgacggcgccgtcgaccggaaaaagcctcacggtgctcgggacggtgttcgtcaac
ctgatcaagatgatgatcgcaccggtcatcttctgcacgatcgtgctcgggatcggctcg
gtgcgcaaagccgcggccgtgggcaaggtcggcgggctggctttggcctactttctaacg
atgtcatcggtggcgctcgggatcgggttgatcgtcggcaacctactcagtccgggtagg
gatctgcaccttaggcctggtgcggtcggaagcggcgcagcattggccggccaggctgcg
gagtcacacggaatcgctgggttcatccagcagatcattccgaggtcgctcccctcagcc
cttactgaaggcaacgtgctgcaggtgttactcgtcgcgctgctggtcggtttcgcggtc
caaggcctgggccccgcaggcgagtccatcctgcgtgccgtcgagaacctgcaaaagctg
gtgttcaaggtgctcgtgatggtactgtggctggctccgatcggcgcgttcggtgcgatc
gccaatatcgtcgccacgactggcttcaacgccgtcaccaacctgctgctgctgatggcc
ggcttctacctgacgtgcgtggtgttcgttttcggcgtcctgggagtgctactgcgcatc
gtgtcgggtttgtcgatctttcggctgctgcgctatctagcccgcgagtacttgctgatc
ttcgcaacatcgtcgtcggaggtggtgctgcccagactgatcaccaagatgaaacacttg
ggcgtgcaatccagcacggtcggcgtggtggtgccgaccggctactcgttcaatcttgac
ggcaccgctatctatctgaccatggcgtcgctgttcatcgccgacgcgatgggacatcgc
ttgacatggggcgagcagatcgcgctgctggcgttcatgatcatcgcgtccaagggcgct
gccggggtcagcggtgcgggccttgcgacgctggccggcggcctgcaggctcatcgcccc
gagctgctggacggtgtcgggctgattgtggggatcgaccggttcatgtcggaagcccgt
tcgctcacgaacttctccggcaacgccgtcgcaaccatcctggttgcctcgtggacaaag
accattgacctgtccaaagccgacgaggtgttgcgcggtcgtgatcccttcgacgaatcg
accatggtcgatccccacgatgaggagccacccgccgccacaccccacgggggcggcgtc
ccgacgaaccctgcgctgtgcgatttcgagcaggtcagtctaggcggattggtgggccgg
ccggccggcccgcaacgcgccgacgtggacgggtag

DBGET integrated database retrieval system