KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_01951Help
Entry
TBSG_01951        CDS       T01690                                 

Definition
pyrazinamidase/nicotinamidas pncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TBSG_01951
Enzymes [BR:mtk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TBSG_01951
    3.5.1.-  
     TBSG_01951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2125562..2126122
Genome map
AA seq 186 aa AA seqDB search
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSG
TPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWL
RQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASV
ELVCSS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgttgatcatcgtcgacgtgcagaacgacttctgcgagggtggctcgctggcg
gtaaccggtggcgccgcgctggcccgcgccatcagcgactacctggccgaagcggcggac
taccatcacgtcgtggcaaccaaggacttccacatcgacccgggtgaccacttctccggc
acaccggactattcctcgtcgtggccaccgcattgcgtcagcggtactcccggcgcggac
ttccatcccagtctggacacgtcggcaatcgaggcggtgttctacaagggtgcctacacc
ggagcgtacagcggcttcgaaggagtcgacgagaacggcacgccactgctgaattggctg
cggcaacgcggcgtcgatgaggtcgatgtggtcggtattgccaccgatcattgtgtgcgc
cagacggccgaggacgcggtacgcaatggcttggccaccagggtgctggtggacctgaca
gcgggtgtgtcggccgataccaccgtcgccgcgctggaggagatgcgcaccgccagcgtc
gagttggtttgcagctcctga

DBGET integrated database retrieval system