KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02067Help
Entry
TBSG_02067        CDS       T01690                                 

Definition
(GenBank) enoyl-CoA hydratase echA13
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00071  Fatty acid degradation
mtk00280  Valine, leucine and isoleucine degradation
mtk00281  Geraniol degradation
mtk00310  Lysine degradation
mtk00360  Phenylalanine metabolism
mtk00362  Benzoate degradation
mtk00380  Tryptophan metabolism
mtk00410  beta-Alanine metabolism
mtk00627  Aminobenzoate degradation
mtk00640  Propanoate metabolism
mtk00650  Butanoate metabolism
mtk00903  Limonene and pinene degradation
mtk00930  Caprolactam degradation
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01120  Microbial metabolism in diverse environments
mtk01130  Biosynthesis of antibiotics
mtk01212  Fatty acid metabolism
Module
mtk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TBSG_02067
   00650 Butanoate metabolism
    TBSG_02067
  Lipid metabolism
   00071 Fatty acid degradation
    TBSG_02067
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBSG_02067
   00310 Lysine degradation
    TBSG_02067
   00360 Phenylalanine metabolism
    TBSG_02067
   00380 Tryptophan metabolism
    TBSG_02067
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBSG_02067
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBSG_02067
   00281 Geraniol degradation
    TBSG_02067
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBSG_02067
   00627 Aminobenzoate degradation
    TBSG_02067
   00930 Caprolactam degradation
    TBSG_02067
Enzymes [BR:mtk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TBSG_02067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEB04196
Position
2232645..2233601
Genome map
AA seq 318 aa AA seqDB search
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIGADEAHALGMVSKVFPADELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRAAPQIRPAIKQRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcggcagggtcggtccggtcgatcgccggtcggacggggaacgctcccgacgg
ccccgggagttcgaatacatccgctacgaaaccatcgacgatgggcgcatcgccgcgatc
accctggaccgcccgaaacaacgcaacgcccagacccgcggcatgctggtcgagctgggc
gccgccttcgaacttgccgaggcggacgacaccgtccgggtggtgatcctgcgggccgcc
ggccccgccttctccgccggtcacgacctcggatccgctgacgatatccgggaacgctcg
cccgggccggaccagcaccccagctaccggtgcaacggggcgaccttcggcggggtcgag
tcacgcaaccgccaggagtggcactactacttcgaaaacaccaagcggtggcgcaacctg
cgcaagatcaccatcgcccaggtgcacggggccgtgctgtcggcggggttgatgctggcc
tggtgctgcgatctgatcgtcgccagcgaggacaccgtgttcgccgatgtggtcggcacc
cggctgggcatgtgcggggtcgagtacttcggacatccgtgggagttcgggccgcgcaag
accaaggaactgctgctcaccggcgactgcataggcgccgacgaggcccacgcgctgggg
atggtcagcaaggtgtttcccgctgacgaactcgcgaccagcacaatcgaattcgcgcgt
cggatcgcgaaggtgccgacgatggcggcactgctgatcaaggaatcggtgaaccaaacc
gtcgatgccatggggttttccgccgcgctggacggttgcttcaagatccaccagctcaat
cacgcgcactggggcgaagtcaccggcggcaagctgtcctacggaacggtcgagtacggc
ctggaggactggcgcgccgcaccgcagatccggcccgcgatcaagcagcggccctga

DBGET integrated database retrieval system