KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02168Help
Entry
TBSG_02168        CDS       T01690                                 

Definition
malate synthase G glcB
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBSG_02168
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBSG_02168
   00630 Glyoxylate and dicarboxylate metabolism
    TBSG_02168
Enzymes [BR:mtk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TBSG_02168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2332693..2334900
Genome map
AA seq 735 aa AA seqDB search
MGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQNQALLNARDELQAQIDK
WHRRRVIEPIDMDAYRQFLTEIGYLLPEPDDFTITTSGVDAEITTTAGPQLVVPVLNARF
ALNAANARWGSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGS
FGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPE
SQVGTTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLAAAVDKD
GTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNDAIVDTDGSEVFEGIMDAL
FTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKMHGPAEVAFTCELFSRVEDVLGLPQNT
MKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRKGTMKSQ
PWILAYEDHNVDAGLAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTAWVPSPT
AATLHALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDNNCQSIL
GYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRASLERMA
PLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRREFKARAA
EKPAPSDRAGDDAAR
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaacttgcgcatcgctcgggtgctctacgacttcgtgaacaatgaagccctgcct
ggcaccgatatcgacccggacagcttctgggcgggcgtcgacaaggtcgtcgccgacctg
accccgcagaaccaagctctgttgaacgcccgcgacgagctgcaggcgcagatcgacaag
tggcaccggcgtcgggtgatcgagcccatcgacatggatgcctaccgccagttcctcacc
gagatcggctacctgcttcccgaacctgatgacttcaccatcaccacgtccggtgtcgac
gctgagatcaccacgaccgccggcccccagctggtggtgccggtgctcaacgcgcggttt
gctctgaacgcggccaacgctcgctggggctccctctacgacgccttgtatggcaccgat
gtcatccccgagaccgacggcgccgaaaaaggccccacgtacaacaaggttcgtggcgac
aaggtgatcgcgtatgcccgcaagttcctcgacgacagtgttccgctgtcgtcgggttcc
tttggcgacgccaccggtttcacagtgcaggatggccagctcgtggttgccttgccggat
aagtccaccggcctggccaaccccggccagttcgccggctacaccggcgcagccgagtcg
ccgacatcggtgctgctaatcaatcacggtttgcacatcgagatcctgatcgatccggag
tcgcaggtcggcaccaccgaccgggccggcgtcaaggacgtgatcctggaatccgcgatc
accacgatcatggacttcgaggactcggtggccgccgtggacgccgccgacaaggtgctg
ggttatcggaactggctcggcctgaacaagggcgacctggcagcagcggtagacaaggac
ggcaccgctttcctgcgggtgctcaatagggaccggaactacaccgcacccggcggtggc
cagttcacgctgcctggacgcagcctcatgttcgtccgcaacgtcggtcacttgatgacg
aatgacgccatcgtcgacactgacggcagcgaggtgttcgaaggcatcatggatgcccta
ttcaccggcctgatcgccatccacgggctaaaggccagcgacgtcaacgggccgctgatc
aacagccgcaccggctccatctacatcgtcaagccgaagatgcacggtccggccgaggtg
gcgtttacctgcgaactgttcagccgggttgaagatgtgctggggttgccgcaaaacacc
atgaagatcggcatcatggacgaggaacgccggaccacggtcaacctcaaggcgtgcatc
aaagctgccgcggaccgcgtggtgttcatcaacaccgggttcctggaccgcaccggcgat
gaaatccacacctcgatggaggccggcccgatggtgcgcaagggcaccatgaagagccag
ccgtggatcttggcctacgaggaccacaacgtcgatgccggcctggccgccgggttcagc
ggccgagcccaggtcggcaagggcatgtggacaatgaccgagctgatggccgacatggtc
gagacaaaaatcgcccagccgcgcgccggggccagcaccgcctgggttccctctcccact
gcggccaccctgcatgcgctgcactaccaccaggtcgacgtcgccgcggtgcaacaagga
ctggcggggaagcgtcgcgccaccatcgaacaattgctgaccattccgctggccaaggaa
ttggcctgggctcccgacgagatccgcgaagaggtcgacaacaactgtcaatccatcctc
ggctacgtggttcgctgggttgatcaaggtgtcggctgctcgaaggtgcccgacatccac
gacgtcgcgctcatggaggaccgggccacgctgcgaatctccagccaattgttggccaac
tggctgcgccacggtgtgatcaccagcgcggatgtgcgggccagcttggagcggatggcg
ccgttggtcgatcgacaaaacgcgggcgacgtggcataccgaccgatggcacccaacttc
gacgacagtatcgccttcctggccgcgcaggagctgatcttgtccggggcccagcagccc
aacggctacaccgagccgatcctgcaccgacgtcgtcgggagtttaaggcccgggccgct
gagaagccggccccatcggacagggccggtgacgatgcggcccgctag

DBGET integrated database retrieval system