KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02305Help
Entry
TBSG_02305        CDS       T01690                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    TBSG_02305
Enzymes [BR:mtk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     TBSG_02305
Exosome [BR:mtk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TBSG_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2489600..2490301
Genome map
AA seq 233 aa AA seqDB search
MAAGIRNITTTGQIGDGREAAAVDYVLAHAGAGNIDDVLATIDKFAYEKSMLINVGDEKG
TLLDAAVRRADPALALELGTYLGYGALRIARAAPEARVYSVELAEANASNARRIWAHAGV
DDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLDHDKKAYLPDLQSILDRGWLHPGS
IVVADNVRVPGAPTYRAYMRRQQGMSWNTIEHKTHLEYQTLVPDLVLESEYLG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgggatccgcaatatcaccacgacgggccagatcggtgatggacgcgaagcg
gcggccgtcgactatgtcctcgcccacgccggggccggcaacatcgacgacgtgctggcc
accatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgacgagaaaggg
acgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggagttgggcacc
tacctcggctacggcgcgctgcggatcgcccgggccgctccggaggccagggtgtactcc
gtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcatgccggcgtc
gatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcaccctggacgcg
ctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgaccatgacaag
aaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcacccgggctcg
atcgtggttgccgacaatgtcagggtgcccggcgcgccgacgtaccgtgcatatatgcgc
cggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaataccagacc
ctggtgcccgacttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system