KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02394Help
Entry
TBSG_02394        CDS       T01690                                 

Definition
tryptophan synthase subunit beta TrpB
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtk01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtk00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mtk00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2607026..2608294)
Genome map
AA seq 422 aa AA seqDB search
MMTDLSTPDLPRMSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKE
RVSQDFLDDLDRLQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQ
ALLARRMGKTRVIAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGA
EVVAVQTGSKTLKDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARV
QIQGQAGRLPDAVVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAG
SPGAFHGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMD
AFGLLCRMEGIIPAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLG
ND
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacagatctatccaccccggatcttccgcgcatgagtgctgccatcgccgaaccg
accagtcacgatcctgattccggcggccatttcggcggccccagtggttggggtggccgc
tacgttcccgaggcgctgatggcggtgatcgaagaggtcaccgccgcctaccaaaaggag
cgcgtcagccaggactttctggacgacctagacaggctgcaggcgaactatgcgggccgg
ccttcgccgctttacgaggcgacccggttgagccagcacgctgggtcggcgcgaatcttt
ctgaagcgagaagacctgaaccatactggttctcacaagatcaacaacgtgctcgggcag
gcactgctggcgcgcaggatgggcaagacccgggtgatcgccgagaccggtgccggccag
cacggggtcgccacggccaccgcatgcgcattgctcggcctggactgtgtcatctacatg
gggggcatcgacaccgcccgtcaggcgctaaacgtggcccggatgcgattgctgggtgcc
gaagtcgtcgcggttcagacgggctcgaaaacgctcaaagacgccatcaatgaggcgttc
cgggattgggttgccaacgccgacaacacctactactgctttggtactgcggccggaccg
catccgtttccaaccatggtgcgcgatttccagcgaatcatcggcatggaggcacgtgtg
cagatccagggtcaggccggtcggctgcctgacgccgtcgtcgcgtgcgttggtggcggg
tccaatgccattggtatttttcatgcgtttctcgatgacccaggcgtacggctggtcgga
ttcgaggcagccggcgacggcgttgagaccggccggcatgccgcgacattcaccgctggt
tcgcccggggcatttcacggatcgttctcgtacttgctgcaagacgaggacggtcagacc
attgaatcccattcaatttccgcgggtctggattatccgggggtgggcccggaacatgcg
tggctcaaggaggccgggcgtgtcgattatcggccgatcaccgactccgaggcgatggac
gcgtttggcctgctgtgtcgcatggaaggcatcatcccggctattgaatccgcgcacgcg
gtggccggcgccctcaagctaggtgttgagttgggaaggggcgcggtgattgtggtgaac
ctgtcgggacgtggcgacaaagatgtcgagacggccgcgaaatggtttggcttgctgggc
aacgactga

DBGET integrated database retrieval system