KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02555Help
Entry
TBSG_02555        CDS       T01690                                 

Definition
(GenBank) triosephosphate isomerase tpi
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00010  Glycolysis / Gluconeogenesis
mtk00051  Fructose and mannose metabolism
mtk00562  Inositol phosphate metabolism
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01120  Microbial metabolism in diverse environments
mtk01130  Biosynthesis of antibiotics
mtk01200  Carbon metabolism
mtk01230  Biosynthesis of amino acids
Module
mtk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtk_M00002  Glycolysis, core module involving three-carbon compounds
mtk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBSG_02555
   00051 Fructose and mannose metabolism
    TBSG_02555
   00562 Inositol phosphate metabolism
    TBSG_02555
Enzymes [BR:mtk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TBSG_02555
Exosome [BR:mtk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TBSG_02555
  Exosomal proteins of bladder cancer cells
   TBSG_02555
  Exosomal proteins of melanoma cells
   TBSG_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB04684
Structure
PDB: 

Jmol
Position
complement(2794008..2794793)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system