KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02555Help
Entry
TBSG_02555        CDS       T01690                                 

Definition
(RefSeq) triosephosphate isomerase tpi
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBSG_02555
   01230 Biosynthesis of amino acids
    TBSG_02555
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBSG_02555
   00051 Fructose and mannose metabolism
    TBSG_02555
   00562 Inositol phosphate metabolism
    TBSG_02555
Enzymes [BR:mtk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TBSG_02555
Exosome [BR:mtk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TBSG_02555
  Exosomal proteins of bladder cancer cells
   TBSG_02555
  Exosomal proteins of melanoma cells
   TBSG_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(2794008..2794793)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system