KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03051Help
Entry
TBSG_03051        CDS       T01690                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mtk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3337451..3338830)
Genome map
AA seq 459 aa AA seqDB search
MSPSNLPRTVGELRAAGHRERGVKQEIRENLLTALADGDNVWPGILGFDDTVIPQVERAL
IAGHDFVLLGERGQGKTRLLRALAGLLDEWTPVIAGAELGEHPYTPITPESIRRAAQLGD
DLPVAWKHRSERYTEKLATPDTSVADLVGDVDPIKVAEGRSLGDPETIAYGLIPRAHRGI
VAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPI
KDRFGAEIRTHYPLELEAEMGVIVQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGV
SARFAIAAAETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGREQAVL
EHLLRRATADTASRVLGGIDVGSLVTAVEGGSAVTTGERVSAKDVLAAVPGLPVVDRIAR
KLGAESEGERAAALELALEALYLAKRVDKVCGEGQTVYG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccagtaacctgccccgcaccgtgggcgagctgcgtgccgccggtcatcgggaa
cggggggtcaagcaggaaatccgggaaaatctgctgaccgcgctggccgacggcgacaac
gtctggccgggcatcctgggtttcgacgacaccgtgattccccaggtggagcgggccttg
atcgccggtcacgactttgtcctgctcggcgaacgcggccagggcaagacccggctgctg
cgcgcactcgcgggtctgctggacgagtggacgccggtgatcgccggcgccgaactgggc
gagcacccctacacgccgatcacgccggagtcgatccggcgggccgcgcagctcggcgac
gacctaccggtggcgtggaagcaccgcagcgagcgctacaccgagaagctggccaccccc
gacaccagcgtcgccgacctggtcggcgacgtcgacccgatcaaggttgccgagggccgc
agcctcggggatcccgaaaccatcgcctacgggctcatcccgcgggcgcaccgcggcatc
gtcgcggtcaacgagctgcccgacctcgccgaacgcatccaggtgtcgatgctcaacgtc
atggaggagcgcgacatccaggtccgcggctacacgctgcggctgccgctggatgtgttg
gtggtcgccagcgccaaccccgaggactacaccaaccgtggccgcatcatcacgcccatc
aaggaccggttcggcgccgagatccgcacccactacccactggagctggaggcggagatg
ggcgtcatcgtccaggaggcgcacctgagtgcacaggtgcccgactacctgatgcaggtg
ctcgcgcggtttgcccgttacctgcgagaatcccgctcgatcgatcagcgctccggggtg
tcggcgcggtttgccatcgcagcggccgaaaccgtggcggctgccgcccggcaccgcggg
gcggtgctgggggagacagacccggtggcccgggtggtcgatttgggcacggtgatcgac
gtgctgcgcggcaagctggaattcgagtccggcgaggagggccgcgaacaggcggtgctc
gagcatctgttgcgtcgcgccaccgccgataccgcgtcccgggtgctgggcggtatcgac
gttggctcgttggtgaccgcggtcgagggcggttcggcggtgacgacgggcgagcgggtc
tcggccaaggatgtgctggcggcggtgccgggcctgccggtggtggacaggatcgcgcgc
aagctgggcgccgaatccgagggggagcgtgccgcggcactggaactggcgttggaggcg
ctatacctggccaagcgcgttgacaaggtctgcggggagggccagaccgtctatggctaa

DBGET integrated database retrieval system