KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03361Help
Entry
TBSG_03361        CDS       T01690                                 

Definition
L-lysine-epsilon aminotransferase lat
Orthology
K03918  
L-lysine 6-transaminase [EC:2.6.1.36]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3665236..3666585)
Genome map
AA seq 449 aa AA seqDB search
MAAVVKSVALAGRPTTPDRVHEVLGRSMLVDGLDIVLDLTRSGGSYLVDAITGRRYLDMF
TFVASSALGMNPPALVDDREFHAELMQAALNKPSNSDVYSVAMARFVETFARVLGDPALP
HLFFVEGGALAVENALKAAFDWKSRHNQAHGIDPALGTQVLHLRGAFHGRSGYTLSLTNT
KPTITARFPKFDWPRIDAPYMRPGLDEPAMAALEAEALRQARAAFETRPHDIACFVAEPI
QGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGK
KTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARRILEVIEAEGLFERAVQH
GKYLRARLDELAADFPAVVLDPRGRGLMCAFSLPTTADRDELIRQLWQRAVIVLPAGADT
VRFRPPLTVSTAEIDAAIAAVRSALPVVT
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcgtgaagtccgtcgctcttgccggtagaccaacaacaccagaccgggtt
catgaggtgctagggcgcagcatgctggtcgacggtctggacatagtgctcgatctgacc
cgttcgggcggttcatatctggtcgacgctataacgggtcggcgctacctggacatgttc
acattcgttgcctcctcggcactgggtatgaatcccccggcgctggtggacgaccgggag
ttccatgccgaactcatgcaggccgcgctgaacaagcccagcaattccgacgtgtactcg
gtggcgatggcccgcttcgtcgagaccttcgcccgtgtcttgggcgacccggcgctgccg
catctgttcttcgtcgaagggggcgccctggcggtggagaacgcgctcaaagccgcgttc
gactggaagagtcggcacaaccaagcccatgggatcgacccggcgctgggcactcaagtg
ctccacctgcgcggggcatttcacggccgcagcggctataccctgtcgctgaccaacacc
aagccgaccattaccgcccggttcccgaaattcgactggccacgcatcgatgcgccgtac
atgcggcccggcctggatgagcccgctatggccgcgctagaggccgaggcgctacgccag
gcccgcgcggcattcgagacccgcccgcacgacatcgcgtgttttgtggccgaacccatc
cagggcgagggtggcgaccgccatttccgcccggagtttttcgctgcgatgcgcgagctg
tgcgacgagtttgatgcactgctgatcttcgacgaagtacagaccggctgcgggttgacc
ggaaccgcctgggcataccagcagttggatgtcgcacccgacatcgtggcgttcggcaag
aagacgcaggtatgcggagtgatggccggtcggcgggtggacgaggtcgccgacaatgtg
ttcgcggtcccatcacggctcaactcgacatggggtggcaatcttaccgacatggtgcgc
gcccgccgcatcttggaggtcatcgaagccgagggcctgttcgagcgggcggtgcagcac
ggtaagtatctgcgcgcccggcttgacgaactcgccgcggacttcccggcagtggttctc
gatccgcgcggccgcgggctgatgtgtgcgtttagcctgccgaccaccgccgaccgtgac
gagttgatccgccagctgtggcaacgtgcggtgattgtgttgccggccggtgcagacacc
gtgcgattccgtccaccgctgacggtttcaaccgccgagatcgacgccgcgatagccgcg
gtgcgcagcgcgttaccggtggtgacgtaa

DBGET integrated database retrieval system