KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03402Help
Entry
TBSG_03402        CDS       T01690                                 

Definition
penicillin-binding protein dacB1
Orthology
K07258  
D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mtk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3708420..3709637
Genome map
AA seq 405 aa AA seqDB search
MAFLRSVSCLAAAVFAVGTGIGLPTAAGEPNAAPAACPYKVSTPPAVDSSEVPAAGEPPL
PLVVPPTPVGGNALGGCGIITAPGSAPAPGDVSAEAWLVADLDSGAVIAARDPHGRHRPA
SVIKVLVAMASINTLTLNKSVAGTADDAAVEGTKVGVNTGGTYTVNQLLHGLLMHSGNDA
AYALARQLGGMPAALEKINLLAAKLGGRDTRVATPSGLDGPGMSTSAYDIGLFYRYAWQN
PVFADIVATRTFDFPGHGDHPGYELENDNQLLYNYPGALGGKTGYTDDAGQTFVGAANRD
GRRLMTVLLHGTRQPIPPWEQAAHLLDYGFNTPAGTQIGTLIEPDPSLMSTDRNPADRQR
VDPQAAARISAADALPVRVGVAVIGALIVFGLIMVARAMNRRPQH
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttacgttcggtatcgtgcctggcagcagccgtgtttgcggtaggcaccgga
attggtctacctaccgcggccggcgaacccaatgccgcaccggcggcgtgcccgtacaag
gtgtccaccccacccgccgtggactcgtcggaggttcccgcggccggtgaacccccactg
ccgctggtggtaccccccaccccggtcggcggcaacgcgctgggcggctgcggcatcatc
accgcccctggcagcgcgccagcgcccggcgacgtctcagccgaggcctggctggtggcg
gacctggacagcggcgcggtgatcgccgcccgggatccgcacggccggcaccgcccggcc
agcgtcatcaaggtgctggtggcgatggcgtccatcaacacgctcaccctcaacaagtcg
gtcgccggaaccgccgacgacgcggcggtcgagggcaccaaagtcggggtgaacaccggt
ggcacctacaccgtcaaccagctgctgcacgggctgctgatgcactccggcaacgacgct
gcgtacgcgctggccaggcagctcggcggcatgccggccgcgctggagaaaatcaatctg
ctggccgccaagctgggcggccgggacacccgagtggccacgccgtccggactggacggg
cccggcatgagcacgtcggcctatgacatcggcctgttctaccggtacgcgtggcagaac
ccggtcttcgccgacatcgtcgcgacccgcaccttcgacttcccggggcacggcgaccat
ccaggctacgagttggagaacgacaaccagctgctctacaactatccgggcgcgctcggc
ggcaagaccggctataccgacgacgcggggcagaccttcgtgggcgcggccaaccgcgac
ggccggcggctgatgacggtgctgctgcacgggacccggcagccgatcccgccgtgggag
caggcggcgcacctgctcgactacgggttcaacaccccggcaggcacccagatcgggaca
ctgatcgaacccgacccgtcgctgatgtccaccgaccgcaatcccgccgaccggcaacga
gtcgacccccaggccgcggcgcggatatcggccgccgacgcccttccggtgcgggttggc
gtggccgtcatcggcgccctgatcgtgttcgggttgatcatggtcgcgcgggcgatgaac
cgccggccgcagcactag

DBGET integrated database retrieval system