KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03402Help
Entry
TBSG_03402        CDS       T01690                                 

Definition
penicillin-binding protein dacB1
Orthology
K07258  
D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TBSG_03402
Enzymes [BR:mtk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TBSG_03402
Peptidases [BR:mtk01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   TBSG_03402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3708420..3709637
Genome map
AA seq 405 aa AA seqDB search
MAFLRSVSCLAAAVFAVGTGIGLPTAAGEPNAAPAACPYKVSTPPAVDSSEVPAAGEPPL
PLVVPPTPVGGNALGGCGIITAPGSAPAPGDVSAEAWLVADLDSGAVIAARDPHGRHRPA
SVIKVLVAMASINTLTLNKSVAGTADDAAVEGTKVGVNTGGTYTVNQLLHGLLMHSGNDA
AYALARQLGGMPAALEKINLLAAKLGGRDTRVATPSGLDGPGMSTSAYDIGLFYRYAWQN
PVFADIVATRTFDFPGHGDHPGYELENDNQLLYNYPGALGGKTGYTDDAGQTFVGAANRD
GRRLMTVLLHGTRQPIPPWEQAAHLLDYGFNTPAGTQIGTLIEPDPSLMSTDRNPADRQR
VDPQAAARISAADALPVRVGVAVIGALIVFGLIMVARAMNRRPQH
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttacgttcggtatcgtgcctggcagcagccgtgtttgcggtaggcaccgga
attggtctacctaccgcggccggcgaacccaatgccgcaccggcggcgtgcccgtacaag
gtgtccaccccacccgccgtggactcgtcggaggttcccgcggccggtgaacccccactg
ccgctggtggtaccccccaccccggtcggcggcaacgcgctgggcggctgcggcatcatc
accgcccctggcagcgcgccagcgcccggcgacgtctcagccgaggcctggctggtggcg
gacctggacagcggcgcggtgatcgccgcccgggatccgcacggccggcaccgcccggcc
agcgtcatcaaggtgctggtggcgatggcgtccatcaacacgctcaccctcaacaagtcg
gtcgccggaaccgccgacgacgcggcggtcgagggcaccaaagtcggggtgaacaccggt
ggcacctacaccgtcaaccagctgctgcacgggctgctgatgcactccggcaacgacgct
gcgtacgcgctggccaggcagctcggcggcatgccggccgcgctggagaaaatcaatctg
ctggccgccaagctgggcggccgggacacccgagtggccacgccgtccggactggacggg
cccggcatgagcacgtcggcctatgacatcggcctgttctaccggtacgcgtggcagaac
ccggtcttcgccgacatcgtcgcgacccgcaccttcgacttcccggggcacggcgaccat
ccaggctacgagttggagaacgacaaccagctgctctacaactatccgggcgcgctcggc
ggcaagaccggctataccgacgacgcggggcagaccttcgtgggcgcggccaaccgcgac
ggccggcggctgatgacggtgctgctgcacgggacccggcagccgatcccgccgtgggag
caggcggcgcacctgctcgactacgggttcaacaccccggcaggcacccagatcgggaca
ctgatcgaacccgacccgtcgctgatgtccaccgaccgcaatcccgccgaccggcaacga
gtcgacccccaggccgcggcgcggatatcggccgccgacgcccttccggtgcgggttggc
gtggccgtcatcggcgccctgatcgtgttcgggttgatcatggtcgcgcgggcgatgaac
cgccggccgcagcactag

DBGET integrated database retrieval system